MRPS17 (mitochondrial ribosomal protein S17)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51373
Gene name Mitochondrial ribosomal protein S17
Gene symbol MRPS17
Synonyms (NCBI Gene)
HSPC011MRP-S17RPMS17S17mtuS17m
Chromosome 7
Chromosome location 7p11.2
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
82 Show/Hide all (82)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT634540 hsa-miR-4714-5p HITS-CLIP 23824327
MIRT634539 hsa-miR-383-3p HITS-CLIP 23824327
MIRT634538 hsa-miR-3921 HITS-CLIP 23824327
MIRT634537 hsa-miR-4653-5p HITS-CLIP 23824327
MIRT634536 hsa-miR-4251 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22 Show/Hide all (22)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0003735 Function Structural constituent of ribosome HDA 11402041
GO:0003735 Function Structural constituent of ribosome IEA
GO:0003735 Function Structural constituent of ribosome NAS 11279123
GO:0005515 Function Protein binding IPI 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611980 14047 ENSG00000239789
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2R5
Protein name Small ribosomal subunit protein uS17m (28S ribosomal protein S17, mitochondrial) (MRP-S17) (S17mt)
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00366 Ribosomal_S17 15 → 83 Ribosomal protein S17 Domain
Sequence 
MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTV
GDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKN
LEELNISSAQ
Sequence length 130
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Ribosome Mitochondrial translation elongation
  Mitochondrial translation termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Acute myeloid leukemia Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Coronary Artery Disease Coronary artery disease Pubtator 33725943 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
MRPL28 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL3 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL10 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL21 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL13 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation.
Diabetes mellitus type 2 Linked via 2 of 5 related genesMRPL10, MRPL21 Bone fracture Linked via 1 of 5 related genesMRPL28 Combined oxidative phosphorylation deficiency Linked via 1 of 5 related genesMRPL3 Mitochondrial disease Linked via 1 of 5 related genesMRPL3 Metabolic syndrome Linked via 1 of 5 related genesMRPL21