Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	6183
Gene name	Mitochondrial ribosomal protein S12
Gene symbol	MRPS12
Synonyms (NCBI Gene)	MPR-S12MT-RPS12RPMS12RPS12RPSM12uS12m
Chromosome	19
Chromosome location	19q13.2
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

53 Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022940	hsa-miR-124-3p	Microarray	18668037
MIRT040468	hsa-miR-615-3p	CLASH	23622248
MIRT1159731	hsa-miR-1182	CLIP-seq
MIRT1159732	hsa-miR-1972	CLIP-seq
MIRT1159733	hsa-miR-205	CLIP-seq
MIRT1159734	hsa-miR-2467-3p	CLIP-seq
MIRT1159735	hsa-miR-3127-3p	CLIP-seq
MIRT1159736	hsa-miR-3616-3p	CLIP-seq
MIRT1159737	hsa-miR-3655	CLIP-seq
MIRT1159738	hsa-miR-431	CLIP-seq
MIRT1159739	hsa-miR-4436b-3p	CLIP-seq
MIRT1159740	hsa-miR-4477a	CLIP-seq
MIRT1159741	hsa-miR-4530	CLIP-seq
MIRT1159742	hsa-miR-4646-3p	CLIP-seq
MIRT1159743	hsa-miR-4650-5p	CLIP-seq
MIRT1159744	hsa-miR-4711-3p	CLIP-seq
MIRT1159745	hsa-miR-4717-5p	CLIP-seq
MIRT1159746	hsa-miR-548aa	CLIP-seq
MIRT1159747	hsa-miR-609	CLIP-seq
MIRT1159748	hsa-miR-922	CLIP-seq
MIRT1159748	hsa-miR-922	CLIP-seq
MIRT2274916	hsa-miR-10a	CLIP-seq
MIRT2274917	hsa-miR-10b	CLIP-seq
MIRT2274918	hsa-miR-338-3p	CLIP-seq
MIRT1159741	hsa-miR-4530	CLIP-seq
MIRT2274919	hsa-miR-4725-5p	CLIP-seq
MIRT2274920	hsa-miR-4751	CLIP-seq
MIRT2274921	hsa-miR-4753-5p	CLIP-seq
MIRT2274922	hsa-miR-504	CLIP-seq
MIRT1159748	hsa-miR-922	CLIP-seq
MIRT2274916	hsa-miR-10a	CLIP-seq
MIRT2274917	hsa-miR-10b	CLIP-seq
MIRT2685342	hsa-miR-1184	CLIP-seq
MIRT2685343	hsa-miR-1205	CLIP-seq
MIRT2685344	hsa-miR-1206	CLIP-seq
MIRT2685345	hsa-miR-1909	CLIP-seq
MIRT2685346	hsa-miR-3158-5p	CLIP-seq
MIRT2685347	hsa-miR-3197	CLIP-seq
MIRT2274918	hsa-miR-338-3p	CLIP-seq
MIRT2685348	hsa-miR-3688-5p	CLIP-seq
MIRT2685349	hsa-miR-4690-3p	CLIP-seq
MIRT2274919	hsa-miR-4725-5p	CLIP-seq
MIRT2274920	hsa-miR-4751	CLIP-seq
MIRT2274921	hsa-miR-4753-5p	CLIP-seq
MIRT2274922	hsa-miR-504	CLIP-seq
MIRT2685350	hsa-miR-518d-5p	CLIP-seq
MIRT2685351	hsa-miR-519b-5p	CLIP-seq
MIRT2685352	hsa-miR-519c-5p	CLIP-seq
MIRT2685353	hsa-miR-520c-5p	CLIP-seq
MIRT2685354	hsa-miR-526a	CLIP-seq
MIRT2685355	hsa-miR-544	CLIP-seq
MIRT2685356	hsa-miR-665	CLIP-seq
MIRT2685357	hsa-miR-885-3p	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	ISS	11402041
GO:0003735	Function	Structural constituent of ribosome	TAS	9545647
GO:0005515	Function	Protein binding	IPI	12646258, 12970870
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005761	Component	Mitochondrial ribosome	TAS	9545647
GO:0005763	Component	Mitochondrial small ribosomal subunit	IDA	25838379
GO:0005763	Component	Mitochondrial small ribosomal subunit	IEA
GO:0005763	Component	Mitochondrial small ribosomal subunit	ISS	11402041
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	25838379
GO:0005840	Component	Ribosome	IBA
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IBA
GO:0006412	Process	Translation	IEA
GO:0015935	Component	Small ribosomal subunit	IEA
GO:0032543	Process	Mitochondrial translation	ISS	11402041
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
603021	10380	ENSG00000128626

O15235

Protein name

Small ribosomal subunit protein uS12m (28S ribosomal protein S12, mitochondrial) (MRP-S12) (S12mt) (MT-RPS12)

PDB

3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00164	Ribosom_S12_S23	42 → 138	Ribosomal protein S12/S23	Family

Sequence

MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKG
VVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPG
VKLTVVRGKYDCGHVQKK

Sequence length

138

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	Mitochondrial translation elongation
	Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MRPS12-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

MRPS12 (mitochondrial ribosomal protein S12)

Bookmark This Gene