MRPL27 (mitochondrial ribosomal protein L27)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51264
• Gene name: Mitochondrial ribosomal protein L27
• Gene symbol: MRPL27
• Synonyms (NCBI Gene): L27mt, bL27m
• Chromosome: 17
• Chromosome location: 17q21.33
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

miRNA Show/Hide all (113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030593	hsa-miR-24-3p	Microarray	19748357
MIRT1158930	hsa-miR-150	CLIP-seq
MIRT1158931	hsa-miR-1976	CLIP-seq
MIRT1158932	hsa-miR-2467-3p	CLIP-seq
MIRT1158933	hsa-miR-3158-5p	CLIP-seq
MIRT1158934	hsa-miR-3678-3p	CLIP-seq
MIRT1158935	hsa-miR-4274	CLIP-seq
MIRT1158936	hsa-miR-4530	CLIP-seq
MIRT1158937	hsa-miR-4704-3p	CLIP-seq
MIRT1158938	hsa-miR-4713-5p	CLIP-seq
MIRT1158939	hsa-miR-532-3p	CLIP-seq
MIRT1158940	hsa-miR-759	CLIP-seq
MIRT2045546	hsa-miR-1236	CLIP-seq
MIRT2045547	hsa-miR-1238	CLIP-seq
MIRT2045548	hsa-miR-149	CLIP-seq
MIRT1158931	hsa-miR-1976	CLIP-seq
MIRT2045549	hsa-miR-24	CLIP-seq
MIRT1158932	hsa-miR-2467-3p	CLIP-seq
MIRT1158933	hsa-miR-3158-5p	CLIP-seq
MIRT2045550	hsa-miR-328	CLIP-seq
MIRT1158934	hsa-miR-3678-3p	CLIP-seq
MIRT2045551	hsa-miR-4284	CLIP-seq
MIRT2045552	hsa-miR-4490	CLIP-seq
MIRT2045553	hsa-miR-4774-5p	CLIP-seq
MIRT2045554	hsa-miR-4780	CLIP-seq
MIRT2045555	hsa-miR-617	CLIP-seq
MIRT2045546	hsa-miR-1236	CLIP-seq
MIRT2045547	hsa-miR-1238	CLIP-seq
MIRT1158930	hsa-miR-150	CLIP-seq
MIRT1158931	hsa-miR-1976	CLIP-seq
MIRT2045550	hsa-miR-328	CLIP-seq
MIRT2274550	hsa-miR-3622a-3p	CLIP-seq
MIRT2274551	hsa-miR-3622b-3p	CLIP-seq
MIRT2274552	hsa-miR-378g	CLIP-seq
MIRT2274553	hsa-miR-3925-3p	CLIP-seq
MIRT2274554	hsa-miR-421	CLIP-seq
MIRT1158935	hsa-miR-4274	CLIP-seq
MIRT2274555	hsa-miR-4421	CLIP-seq
MIRT2274556	hsa-miR-4437	CLIP-seq
MIRT2045552	hsa-miR-4490	CLIP-seq
MIRT1158936	hsa-miR-4530	CLIP-seq
MIRT2274557	hsa-miR-4674	CLIP-seq
MIRT2274558	hsa-miR-4700-3p	CLIP-seq
MIRT1158937	hsa-miR-4704-3p	CLIP-seq
MIRT2274559	hsa-miR-4709-5p	CLIP-seq
MIRT1158938	hsa-miR-4713-5p	CLIP-seq
MIRT2274560	hsa-miR-4726-3p	CLIP-seq
MIRT2274561	hsa-miR-4757-5p	CLIP-seq
MIRT2045553	hsa-miR-4774-5p	CLIP-seq
MIRT2045554	hsa-miR-4780	CLIP-seq
MIRT1158939	hsa-miR-532-3p	CLIP-seq
MIRT2274562	hsa-miR-593	CLIP-seq
MIRT2045555	hsa-miR-617	CLIP-seq
MIRT2045546	hsa-miR-1236	CLIP-seq
MIRT2045547	hsa-miR-1238	CLIP-seq
MIRT2045548	hsa-miR-149	CLIP-seq
MIRT1158930	hsa-miR-150	CLIP-seq
MIRT1158931	hsa-miR-1976	CLIP-seq
MIRT2045549	hsa-miR-24	CLIP-seq
MIRT1158932	hsa-miR-2467-3p	CLIP-seq
MIRT1158933	hsa-miR-3158-5p	CLIP-seq
MIRT2045550	hsa-miR-328	CLIP-seq
MIRT2274550	hsa-miR-3622a-3p	CLIP-seq
MIRT2274551	hsa-miR-3622b-3p	CLIP-seq
MIRT1158934	hsa-miR-3678-3p	CLIP-seq
MIRT2274552	hsa-miR-378g	CLIP-seq
MIRT2274553	hsa-miR-3925-3p	CLIP-seq
MIRT2274554	hsa-miR-421	CLIP-seq
MIRT1158935	hsa-miR-4274	CLIP-seq
MIRT2045551	hsa-miR-4284	CLIP-seq
MIRT2573333	hsa-miR-4436a	CLIP-seq
MIRT2274556	hsa-miR-4437	CLIP-seq
MIRT1158936	hsa-miR-4530	CLIP-seq
MIRT2274557	hsa-miR-4674	CLIP-seq
MIRT2274558	hsa-miR-4700-3p	CLIP-seq
MIRT1158937	hsa-miR-4704-3p	CLIP-seq
MIRT2274559	hsa-miR-4709-5p	CLIP-seq
MIRT1158938	hsa-miR-4713-5p	CLIP-seq
MIRT2274560	hsa-miR-4726-3p	CLIP-seq
MIRT2274561	hsa-miR-4757-5p	CLIP-seq
MIRT1158939	hsa-miR-532-3p	CLIP-seq
MIRT2274562	hsa-miR-593	CLIP-seq
MIRT1158940	hsa-miR-759	CLIP-seq
MIRT2045546	hsa-miR-1236	CLIP-seq
MIRT2045547	hsa-miR-1238	CLIP-seq
MIRT2045548	hsa-miR-149	CLIP-seq
MIRT1158930	hsa-miR-150	CLIP-seq
MIRT1158931	hsa-miR-1976	CLIP-seq
MIRT2045549	hsa-miR-24	CLIP-seq
MIRT1158932	hsa-miR-2467-3p	CLIP-seq
MIRT1158933	hsa-miR-3158-5p	CLIP-seq
MIRT2045550	hsa-miR-328	CLIP-seq
MIRT2274550	hsa-miR-3622a-3p	CLIP-seq
MIRT2274551	hsa-miR-3622b-3p	CLIP-seq
MIRT1158934	hsa-miR-3678-3p	CLIP-seq
MIRT2274552	hsa-miR-378g	CLIP-seq
MIRT2274553	hsa-miR-3925-3p	CLIP-seq
MIRT2274554	hsa-miR-421	CLIP-seq
MIRT1158935	hsa-miR-4274	CLIP-seq
MIRT2045551	hsa-miR-4284	CLIP-seq
MIRT2573333	hsa-miR-4436a	CLIP-seq
MIRT2274556	hsa-miR-4437	CLIP-seq
MIRT1158936	hsa-miR-4530	CLIP-seq
MIRT2274557	hsa-miR-4674	CLIP-seq
MIRT2274558	hsa-miR-4700-3p	CLIP-seq
MIRT1158937	hsa-miR-4704-3p	CLIP-seq
MIRT2274559	hsa-miR-4709-5p	CLIP-seq
MIRT1158938	hsa-miR-4713-5p	CLIP-seq
MIRT2274560	hsa-miR-4726-3p	CLIP-seq
MIRT2274561	hsa-miR-4757-5p	CLIP-seq
MIRT1158939	hsa-miR-532-3p	CLIP-seq
MIRT2274562	hsa-miR-593	CLIP-seq
MIRT1158940	hsa-miR-759	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	NAS	11279069
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	11279069, 25278503
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	NAS	11279069
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 611837
• HGNC: 14483
• e!Ensembl: ENSG00000108826

Protein

• UniProt ID: Q9P0M9
• Protein name: Large ribosomal subunit protein bL27m (39S ribosomal protein L27, mitochondrial) (L27mt) (MRP-L27)
• PDB: 3IY9 , 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01016	Ribosomal_L27	31 → 114	Ribosomal L27 protein	Family

• Sequence:

  MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHY
  VHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRL
  PKGAVLYKTFVHVVPAKPEGTFKLVAML

• Sequence length: 148

Pathways

KEGG Pathway	Reactome Pathway
Ribosome	Mitochondrial translation elongation
	Mitochondrial translation termination

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MRPL28 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL3 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL10 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL21 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL13 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MRPL28	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL3	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL10	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL21	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL13	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 2 of 5 related genesMRPL10, MRPL21 Bone fracture Linked via 1 of 5 related genesMRPL28 Combined oxidative phosphorylation deficiency Linked via 1 of 5 related genesMRPL3 Mitochondrial disease Linked via 1 of 5 related genesMRPL3 Metabolic syndrome Linked via 1 of 5 related genesMRPL21

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	2	["MRPL10","MRPL21"]
Bone fracture	1	["MRPL28"]
Combined oxidative phosphorylation deficiency	1	["MRPL3"]
Mitochondrial disease	1	["MRPL3"]
Metabolic syndrome	1	["MRPL21"]