Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55052
Gene name	Mitochondrial ribosomal protein L20
Gene symbol	MRPL20
Synonyms (NCBI Gene)	L20mtMRP-L20bL20m
Chromosome	1
Chromosome location	1p36.33
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

45 Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001440	hsa-miR-16-5p	pSILAC	18668040
MIRT1158820	hsa-miR-1294	CLIP-seq
MIRT1158821	hsa-miR-132	CLIP-seq
MIRT1158822	hsa-miR-212	CLIP-seq
MIRT1158823	hsa-miR-2467-5p	CLIP-seq
MIRT1158824	hsa-miR-3120-3p	CLIP-seq
MIRT1158825	hsa-miR-3120-5p	CLIP-seq
MIRT1158826	hsa-miR-3188	CLIP-seq
MIRT1158827	hsa-miR-3664-5p	CLIP-seq
MIRT1158828	hsa-miR-3685	CLIP-seq
MIRT1158829	hsa-miR-384	CLIP-seq
MIRT1158830	hsa-miR-3975	CLIP-seq
MIRT1158831	hsa-miR-4316	CLIP-seq
MIRT1158832	hsa-miR-4677-3p	CLIP-seq
MIRT1158833	hsa-miR-4679	CLIP-seq
MIRT1158834	hsa-miR-4709-5p	CLIP-seq
MIRT1158835	hsa-miR-4714-5p	CLIP-seq
MIRT1158836	hsa-miR-4753-3p	CLIP-seq
MIRT1158837	hsa-miR-485-5p	CLIP-seq
MIRT1158838	hsa-miR-495	CLIP-seq
MIRT1158839	hsa-miR-593	CLIP-seq
MIRT1158840	hsa-miR-760	CLIP-seq
MIRT1158820	hsa-miR-1294	CLIP-seq
MIRT2045526	hsa-miR-1298	CLIP-seq
MIRT1158823	hsa-miR-2467-5p	CLIP-seq
MIRT1158826	hsa-miR-3188	CLIP-seq
MIRT2045527	hsa-miR-377	CLIP-seq
MIRT2045528	hsa-miR-3913-3p	CLIP-seq
MIRT1158830	hsa-miR-3975	CLIP-seq
MIRT1158831	hsa-miR-4316	CLIP-seq
MIRT1158832	hsa-miR-4677-3p	CLIP-seq
MIRT1158833	hsa-miR-4679	CLIP-seq
MIRT2045529	hsa-miR-4802-3p	CLIP-seq
MIRT1158837	hsa-miR-485-5p	CLIP-seq
MIRT1158840	hsa-miR-760	CLIP-seq
MIRT1158820	hsa-miR-1294	CLIP-seq
MIRT1158823	hsa-miR-2467-5p	CLIP-seq
MIRT1158826	hsa-miR-3188	CLIP-seq
MIRT2274539	hsa-miR-3918	CLIP-seq
MIRT1158830	hsa-miR-3975	CLIP-seq
MIRT1158831	hsa-miR-4316	CLIP-seq
MIRT1158832	hsa-miR-4677-3p	CLIP-seq
MIRT1158833	hsa-miR-4679	CLIP-seq
MIRT1158837	hsa-miR-485-5p	CLIP-seq
MIRT1158840	hsa-miR-760	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	20601428
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005761	Component	Mitochondrial ribosome	IBA
GO:0005761	Component	Mitochondrial ribosome	IDA	20601428
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0019843	Function	RRNA binding	IEA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611833	14478	ENSG00000242485

Q9BYC9

Protein name

Large ribosomal subunit protein bL20m (39S ribosomal protein L20, mitochondrial) (L20mt) (MRP-L20)

PDB

3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00453	Ribosomal_L20	11 → 116	Ribosomal protein L20	Family

Sequence

MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLK
KKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALA
SRRRHEGFAAALGDGKEPEGIFSRVVQYH

Sequence length

149

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	Mitochondrial translation elongation
	Mitochondrial translation termination

MRPL20 (mitochondrial ribosomal protein L20)

Save This Analysis