Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	65008
Gene name	Mitochondrial ribosomal protein L1
Gene symbol	MRPL1
Synonyms (NCBI Gene)	BM022L1MTMRP-L1uL1m
Chromosome	4
Chromosome location	4q21.1
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

9 Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031403	hsa-miR-16-5p	Proteomics	18668040
MIRT1158428	hsa-miR-1297	CLIP-seq
MIRT1158429	hsa-miR-26a	CLIP-seq
MIRT1158430	hsa-miR-26b	CLIP-seq
MIRT1158431	hsa-miR-4465	CLIP-seq
MIRT1158432	hsa-miR-498	CLIP-seq
MIRT1158433	hsa-miR-561	CLIP-seq
MIRT2274392	hsa-miR-197	CLIP-seq
MIRT2274393	hsa-miR-513b	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0015934	Component	Large ribosomal subunit	IEA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611821	14275	ENSG00000169288

Q9BYD6

Protein name

Large ribosomal subunit protein uL1m (39S ribosomal protein L1, mitochondrial) (L1mt) (MRP-L1)

PDB

7A5K , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8OIR , 8OIT , 8RRI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00687	Ribosomal_L1	47 → 301	Ribosomal protein L1p/L10e family	Domain

Sequence

MAAAVRCMGRALIHHQRHSLSKMVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEK
TPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQS
VYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGG
TSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNG
HEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTS
EGLLLKIDPLLPKEVKNEESEKEDA

Sequence length

325

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ribosome	Mitochondrial translation elongation
	Mitochondrial translation termination

MRPL1 (mitochondrial ribosomal protein L1)

Save This Analysis