MRGPRX4 (MAS related GPR family member X4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 117196
Gene name MAS related GPR family member X4
Gene symbol MRGPRX4
Synonyms (NCBI Gene)
GPCRMRGX4SNSR6
Chromosome 11
Chromosome location 11p15.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607230 17617 ENSG00000179817
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LA9
Protein name Mas-related G-protein coupled receptor member X4 (Sensory neuron-specific G-protein coupled receptor 5/6)
Protein function Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins (By similarity).
PDB 7S8P , 8K4S , 8KEX , 8YRG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 44 → 272 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Uniquely localized in a subset of small dorsal root and trigeminal sensory neurons. {ECO:0000269|PubMed:11850634}.
Sequence 
MDPTVPVFGTKLTPINGREETPCYNQTLSFTVLTCIISLVGLTGNAVVLWLLGYRMRRNA
VSIYILNLAAADFLFLSFQIIRLPLRLINISHLIRKILVSVMTFPYFTGLSMLSAISTER
CLSVLWPIWYRCRRPTHLSAVVCVLLWGLSLLFSMLEWRFCDFLFSGADSSWCETSDFIP
VAWLIFLCVVLCVSSLVLLVRILCGSRKMPLTRLYVTILLTVLVFLLCGLPFGILGALIY
RMHLNLEVLYCHVYLVCMSLSSLNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDKPE
VDKGEGQLPEESLELSGSRLGP
Sequence length 322
Interactions View interactions

No strongly related genes found yet for MRGPRX4.

No additional diseases found yet through genes similar to MRGPRX4.