MRGPRX3 (MAS related GPR family member X3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 117195
Gene name MAS related GPR family member X3
Gene symbol MRGPRX3
Synonyms (NCBI Gene)
GPCRMRGX3SNSR1SNSR2
Chromosome 11
Chromosome location 11p15.1
Summary This gene encodes a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. The encoded protein may be involved in sensory neuron regulation and in the modulation of pain. [provided by RefSeq, Oct 2009]
miRNA miRNA information provided by mirtarbase database.
11 Show/Hide all (11)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018538 hsa-miR-335-5p Microarray 18185580
MIRT1158059 hsa-miR-2467-3p CLIP-seq
MIRT1158060 hsa-miR-3120-5p CLIP-seq
MIRT1158061 hsa-miR-3660 CLIP-seq
MIRT1158062 hsa-miR-4257 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607229 17980 ENSG00000179826
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LB0
Protein name Mas-related G-protein coupled receptor member X3 (Sensory neuron-specific G-protein coupled receptor 1/2)
Protein function Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 44 → 272 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Uniquely localized in a subset of small dorsal root and trigeminal sensory neurons. {ECO:0000269|PubMed:11850634}.
Sequence 
MDSTIPVLGTELTPINGREETPCYKQTLSFTGLTCIVSLVALTGNAVVLWLLGCRMRRNA
VSIYILNLVAADFLFLSGHIICSPLRLINIRHPISKILSPVMTFPYFIGLSMLSAISTER
CLSILWPIWYHCRRPRYLSSVMCVLLWALSLLRSILEWMFCDFLFSGANSVWCETSDFIT
IAWLVFLCVVLCGSSLVLLVRILCGSRKMPLTRLYVTILLTVLVFLLCGLPFGIQWALFS
RIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPE
VDEGGGWLPQETLELSGSRLEQ
Sequence length 322
Interactions View interactions

No strongly related genes found yet for MRGPRX3.

No additional diseases found yet through genes similar to MRGPRX3.