MRGPRX1 (MAS related GPR family member X1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 259249
Gene name MAS related GPR family member X1
Gene symbol MRGPRX1
Synonyms (NCBI Gene)
GPCRMGRG2MRGX1SNSR4
Chromosome 11
Chromosome location 11p15.1|11
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT021582 hsa-miR-142-3p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IMP 20004959
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607227 17962 ENSG00000170255
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LB2
Protein name Mas-related G-protein coupled receptor member X1 (Sensory neuron-specific G-protein coupled receptor 3/4)
Protein function Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins including BAM22 (bovine adrenal medu
PDB 8DWC , 8DWG , 8DWH , 8HJ5 , 8JGB , 8JGF , 8JGG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 44 → 272 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Uniquely localized in a subset of small dorsal root and trigeminal sensory neurons. {ECO:0000269|PubMed:11850634}.
Sequence 
MDPTISTLDTELTPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNA
FSIYILNLAAADFLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTER
CLSVLWPIWYRCHRPTHLSAVVCVLLWALSLLRSILEWMLCGFLFSGADSAWCQTSDFIT
VAWLIFLCVVLCGSSLVLLIRILCGSRKIPLTRLYVTILLTVLVFLLCGLPFGIQFFLFL
WIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASE
VDEGGGQLPEEILELSGSRLEQ
Sequence length 322
Interactions View interactions

No strongly related genes found yet for MRGPRX1.

No additional diseases found yet through genes similar to MRGPRX1.