MRGPRG (MAS related GPR family member G)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 386746
Gene name MAS related GPR family member G
Gene symbol MRGPRG
Synonyms (NCBI Gene)
GPR169MRGG
Chromosome 11
Chromosome location 11p15.4
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607234 24829 ENSG00000182170
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86SM5
Protein name Mas-related G-protein coupled receptor member G (G-protein coupled receptor 169)
Protein function Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).
Family and domains
Sequence 
MFGLFGLWRTFDSVVFYLTLIVGLGGPVGNGLVLWNLGFRIKKGPFSIYLLHLAAADFLF
LSCRVGFSVAQAALGAQDTLYFVLTFLWFAVGLWLLAAFSVERCLSDLFPACYQGCRPRH
ASAVLCALVWTPTLPAVPLPANACGLLRNSACPLVCPRYHVASVTWFLVLARVAWTAGVV
LFVWVTCCSTRPRPRLYGIVLGALLLLFFCGLPSVFYWSLQPLLNFLLPVFSPLATLLAC
VNSSSKPLIYSGLGRQPGKREPLRSVLRRALGEGAELGARGQSLPMGLL
Sequence length 289
Interactions View interactions

No strongly related genes found yet for MRGPRG.

No additional diseases found yet through genes similar to MRGPRG.