MRGPRD (MAS related GPR family member D)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 116512
Gene name MAS related GPR family member D
Gene symbol MRGPRD
Synonyms (NCBI Gene)
MRGDTGR7
Chromosome 11
Chromosome location 11q13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002033 Process Angiotensin-mediated vasodilation involved in regulation of systemic arterial blood pressure IEA
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005615 Component Extracellular space HDA 22664934
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607231 29626 ENSG00000172938
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TDS7
Protein name Mas-related G-protein coupled receptor member D (Beta-alanine receptor) (G-protein coupled receptor TGR7)
Protein function May regulate nociceptor function and/or development, including the sensation or modulation of pain. Functions as a specific membrane receptor for beta-alanine. Beta-alanine at micromolar doses specifically evoked Ca(2+) influx in cells expressin
PDB 7Y12 , 7Y13 , 7Y14 , 7Y15 , 9DQH , 9DQJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 44 → 276 7 transmembrane receptor (rhodopsin family) Family
Sequence 
MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNP
FCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAIS
TQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDM
VQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIY
WFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQAL
REEPELEGGETPTVGTNEMGA
Sequence length 321
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Renin-angiotensin system

No strongly related genes found yet for MRGPRD.

No additional diseases found yet through genes similar to MRGPRD.