MPZL3 (myelin protein zero like 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 196264
• Gene name: Myelin protein zero like 3
• Gene symbol: MPZL3
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q23.3

miRNA Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT531432	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT531430	hsa-miR-4729	PAR-CLIP	22012620
MIRT531431	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT531429	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT531428	hsa-miR-5696	PAR-CLIP	22012620
MIRT531427	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT531426	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT531425	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT531432	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT531430	hsa-miR-4729	PAR-CLIP	22012620
MIRT531431	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT531429	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT531428	hsa-miR-5696	PAR-CLIP	22012620
MIRT531427	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT531426	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT531425	hsa-miR-4436b-5p	PAR-CLIP	22012620
MIRT1157344	hsa-miR-4271	CLIP-seq
MIRT1157345	hsa-miR-4725-3p	CLIP-seq
MIRT1157346	hsa-miR-4760-3p	CLIP-seq
MIRT1157347	hsa-miR-488	CLIP-seq
MIRT1157348	hsa-miR-664	CLIP-seq
MIRT2045073	hsa-miR-1298	CLIP-seq
MIRT2045074	hsa-miR-3120-3p	CLIP-seq
MIRT1157344	hsa-miR-4271	CLIP-seq
MIRT2045075	hsa-miR-4275	CLIP-seq
MIRT2045076	hsa-miR-4693-3p	CLIP-seq
MIRT2045077	hsa-miR-4712-3p	CLIP-seq
MIRT1157345	hsa-miR-4725-3p	CLIP-seq
MIRT1157346	hsa-miR-4760-3p	CLIP-seq
MIRT1157347	hsa-miR-488	CLIP-seq
MIRT2045078	hsa-miR-627	CLIP-seq
MIRT1157348	hsa-miR-664	CLIP-seq
MIRT2045079	hsa-miR-924	CLIP-seq
MIRT1157344	hsa-miR-4271	CLIP-seq
MIRT1157345	hsa-miR-4725-3p	CLIP-seq
MIRT1157346	hsa-miR-4760-3p	CLIP-seq
MIRT1157347	hsa-miR-488	CLIP-seq
MIRT1157348	hsa-miR-664	CLIP-seq
MIRT2572977	hsa-miR-4272	CLIP-seq
MIRT2572977	hsa-miR-4272	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21982860
GO:0005886	Component	Plasma membrane	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0016020	Component	Membrane	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0042633	Process	Hair cycle	IEA

Other IDs

• MIM: 611707
• HGNC: 27279
• e!Ensembl: ENSG00000160588

Protein

• UniProt ID: Q6UWV2
• Protein name: Myelin protein zero-like protein 3
• Protein function: Mediates homophilic cell-cell adhesion.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	36 → 148	Immunoglobulin V-set domain	Domain

• Sequence:

  MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDV
  TDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTI
  KDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVR
  MGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY

• Sequence length: 235

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
LUNG ADENOCARCINOMA	—	GWAS catalog	31326317, 32889700, 35915169, 39366959	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	37846649	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	31326317, 32889700	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	31326317		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	19054061		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30307058		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30307058		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	GWASCAT_DG	31326317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	30307058, 31310695		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for MPZL3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MPZL3.