MPTX1 (mucosal pentraxin 1 (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 649458
Gene name Mucosal pentraxin 1 (pseudogene)
Gene symbol MPTX1
Synonyms (NCBI Gene)
MPTX
Chromosome 1
Chromosome location 1q23.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 48364 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MV57
Protein name Putative mucosal pentraxin homolog
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00354 Pentaxin 1 → 133 Pentaxin family Domain
Tissue specificity TISSUE SPECIFICITY: Not expressed in the intestinal tract including ascending colon, descending colon and rectum. Not expressed in the human colon cancer cell lines HT-29 and CaCo-2. {ECO:0000269|PubMed:18850182}.
Sequence 
MGMYLLHIGNAAVTFNGPTPCPRSPYASTHVNVSWESASGIATLWANGKLVGRKGVWKGY
SVGEEAKIILGQEQDSFGGHFDENQSFVGVIWDVFLWDHVLPPKEMCDSCYSGSLLNRHT
LTYEDNGYVVTKPKVWA
Sequence length 137
Interactions View interactions

No strongly related genes found yet for MPTX1.

No additional diseases found yet through genes similar to MPTX1.