MPO (myeloperoxidase)

Gene

• Entrez ID: 4353
• Gene name: Myeloperoxidase
• Gene symbol: MPO
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q22
• Summary: Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heav

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs35897051	T>G	Pathogenic	Splice acceptor variant
rs78950939	T>C	Pathogenic	Missense variant, coding sequence variant
rs119468010	G>A	Pathogenic	Coding sequence variant, missense variant
rs119469012	A>C,G	Pathogenic	Coding sequence variant, missense variant
rs119469013	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs119469014	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs536522394	TTGGGTTCCATGGG>-,TTGGGTTCCATGGGTTGGGTTCCATGGG	Pathogenic, pathogenic-likely-pathogenic	Frameshift variant, coding sequence variant
rs762933005	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs778013714	C>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1555607599	A>G	Likely-pathogenic	Splice donor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT532437	hsa-miR-8485	PAR-CLIP	20371350
MIRT532436	hsa-miR-1324	PAR-CLIP	20371350
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	20371350
MIRT532437	hsa-miR-8485	PAR-CLIP	22012620
MIRT532436	hsa-miR-1324	PAR-CLIP	22012620
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	22012620
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	27292025
MIRT532436	hsa-miR-1324	PAR-CLIP	27292025
MIRT532436	hsa-miR-1324	PAR-CLIP	27292025
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	27292025
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	27292025
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	20371350
MIRT532436	hsa-miR-1324	PAR-CLIP	20371350
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	20371350
MIRT532437	hsa-miR-8485	PAR-CLIP	22012620
MIRT532436	hsa-miR-1324	PAR-CLIP	22012620
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	22012620
MIRT1156259	hsa-miR-3646	CLIP-seq
MIRT1156260	hsa-miR-3907	CLIP-seq
MIRT1156261	hsa-miR-3915	CLIP-seq
MIRT1156262	hsa-miR-3928	CLIP-seq
MIRT1156263	hsa-miR-451b	CLIP-seq
MIRT1156264	hsa-miR-4694-3p	CLIP-seq
MIRT1156265	hsa-miR-4710	CLIP-seq
MIRT1156266	hsa-miR-522	CLIP-seq
MIRT1156260	hsa-miR-3907	CLIP-seq
MIRT2273957	hsa-miR-3194-3p	CLIP-seq
MIRT1156260	hsa-miR-3907	CLIP-seq
MIRT2273958	hsa-miR-4267	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RUNX1	Unknown	11023523
SP1	Activation	17521322;8662930
SP1	Unknown	12057865

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001878	Process	Response to yeast	IEA
GO:0002149	Process	Hypochlorous acid biosynthetic process	IEA
GO:0002679	Process	Respiratory burst involved in defense response	IEA
GO:0003682	Function	Chromatin binding	TAS	2829220
GO:0004601	Function	Peroxidase activity	IBA
GO:0004601	Function	Peroxidase activity	IDA	10772654, 11907569, 24035742
GO:0004601	Function	Peroxidase activity	IEA
GO:0004601	Function	Peroxidase activity	TAS	10777476
GO:0005515	Function	Protein binding	IPI	24355864, 32814053, 36417879
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10772654, 25645918
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	TAS	2829220
GO:0005654	Component	Nucleoplasm	IDA
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	TAS	8621627
GO:0006952	Process	Defense response	IEA
GO:0006952	Process	Defense response	TAS	8621627
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	TAS	2829220, 2903767
GO:0008201	Function	Heparin binding	IDA	11907569
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019430	Process	Removal of superoxide radicals	IEA
GO:0020037	Function	Heme binding	IEA
GO:0030141	Component	Secretory granule	IDA	11907569
GO:0032094	Process	Response to food	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034374	Process	Low-density lipoprotein particle remodeling	IDA	10772654
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042582	Component	Azurophil granule	IDA	2981589
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	11907569
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	10772654
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10801811
GO:0046872	Function	Metal ion binding	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:1990268	Process	Response to gold nanoparticle	IEA

Other IDs

• MIM: 606989
• HGNC: 7218
• e!Ensembl: ENSG00000005381

Protein

• UniProt ID: P05164
• Protein name: Myeloperoxidase (MPO) (EC 1.11.2.2) [Cleaved into: Myeloperoxidase; 89 kDa myeloperoxidase; 84 kDa myeloperoxidase; Myeloperoxidase light chain; Myeloperoxidase heavy chain]
• Protein function: Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid
• PDB: 1CXP, 1D2V, 1D5L, 1D7W, 1DNU, 1DNW, 1MHL, 1MYP, 3F9P, 3ZS0, 3ZS1, 4C1M, 4DL1, 4EJX, 5FIW, 5MFA, 5UZU, 6AZP, 6BMT, 7OIH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03098	An_peroxidase	173 → 718	Animal haem peroxidase	Domain

• Sequence:

  MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
  LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
  VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
  NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
  QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
  PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
  GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
  REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
  SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
  GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
  AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
  LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
  NSYPRDFVNCSTLPALNLASWREAS

• Sequence length: 745

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute myeloid leukemia	Likely pathogenic	rs762526880	RCV005922469	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Alzheimer disease type 1	Likely pathogenic; Pathogenic	rs119468010, rs762526880	RCV002490304 RCV002503272	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MPO-related disorder	Likely pathogenic; Pathogenic	rs754632893, rs119468010, rs536522394, rs119469014	RCV003416446 RCV003415644 RCV003952340 RCV003894789	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Myeloperoxidase deficiency	Likely pathogenic; Pathogenic	rs754632893, rs181494077, rs119468010, rs536522394, rs119469012, rs119469013, rs119469014, rs773478778, rs1970491995, rs762933005, rs762526880	RCV001784671 RCV001784672 RCV000003810 RCV000003813 RCV000003815 RCV000003819 RCV000003820 RCV003388922 RCV004566634 RCV005356058 RCV002503272	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Alzheimer disease	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE, FAMILIAL, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema with normal C1Inh	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer, protection against, in smokers	protective; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCCUPATIONAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRICHURIASIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	27666673, 30926484		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	15023809		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	12952835		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	19877306, 25164947, 28491088, 29572498, 29594375, 29618370, 30456985, 30889221, 31053235, 31341419		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	20623750		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10363160, 16298822, 17479404, 2173803, 22261446, 2553160, 27392123, 28625325, 29441563, 7493141, 7866270, 8118606, 8269279, 8396697, 8501986, 8613429, 9140287, 9217186		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10025890, 11167741, 11774269, 12041882, 1707229, 19593802, 2166608, 2170780, 2458150, 28340210, 29244249, 3031662, 8152261, 8394481, 8955614, 9140287, 9217186, 9802341		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	2164321, 2541607, 2545574		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10446492, 11835327, 16457884, 17763467, 21674360, 29200171		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	10391105, 11337024, 17763467, 8980370		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia with multilineage dysplasia	Myeloid Leukemia With Multilineage Dysplasia	BEFREE	19737652		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	1878594		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	1382546, 17763467, 7630202, 9002966		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	7493141, 9326240		★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	28359218		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	18452188, 27921358, 28648518, 28686973, 28759809, 28861174, 29328945, 29511434, 29550797, 29593801, 29595543, 29784598, 30119202, 30307087, 30685119, 30753778, 31050811, 31122822, 31347703, 31606729, 31688596		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	12888896, 2172659, 2410066, 2821913, 2823022, 2825962, 2838781, 28754375, 2896388, 29274134, 3023307, 3029127, 3036007, 31829759, 7500643, 7517211, 9326240		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	2790199, 3104260, 7630202		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16195240		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12397651, 23979979		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	18205184		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28356561		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	22126566		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11447748, 11774269, 12041882, 1707229, 2170780, 2458150, 8394481, 8955614		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	17763467		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	27171278		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	20364045		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	11147929		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	10588615		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32171317, 37959001	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	15023809		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	15023809		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	15023809		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	15023809		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30923957, 31401698, 31565748		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	15996936, 28209096		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	LHGDN	15996936		★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	12097534, 8606272	Inhibit	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	32481400	Stimulate	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	26654922	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	25301710	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31611761		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31611761		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29318193		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28971841, 29758327, 30822810, 31466471		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	30952530		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	28624043		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10608505, 11181641, 11479475, 11594511, 12355548, 12818404, 12861032, 12915675, 14668325, 15911707, 16289072, 16639078, 16956579, 18280811, 18344624, 19126404, 19305414, 21950958, 23619367, 24407029, 25759391, 25764050, 25812586, 26453564, 27184954, 27884085, 28069522, 28074342, 28818791, 28864169, 29581235, 30044189, 30056589, 30108726, 30300402, 30889221, 31002727, 31043077, 31307008, 31386835, 31622668, 31653520		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23509155, 30395975, 31365139		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33139352	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34480465	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	32947961	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24928093, 27765067, 31430907, 33469455, 39456241	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	18420450		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16385446, 19544176, 19897513, 20536280, 23204253, 28596972, 28684908, 31100413, 31346991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16385446, 19897513, 28659663	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	23794464	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11549584	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10608505, 11181641, 11479475, 11594511, 12355548, 12818404, 12861032, 12915675, 14668325, 15911707, 16289072, 16639078, 16956579, 18280811, 18344624, 19126404, 19305414, 21950958, 23619367, 24407029, 25759391, 25764050, 25812586, 26453564, 27184954, 27884085, 28069522, 28074342, 28818791, 28864169, 29581235, 30044189, 30056589, 30108726, 30300402, 30889221, 31002727, 31043077, 31307008, 31386835, 31622668, 31653520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	11238037, 12861032, 16326702, 19625608, 20385548, 21235354, 21820048, 22219194, 24746542, 31307008, 33631301, 39456241, 9033274	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	15911707, 17875305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31236695		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33460291, 37280612	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33460291	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	17451207, 18505072	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12027420, 15507771, 28511921, 28954887, 29241626, 31147365, 31337690, 31358739, 31383567, 31443998		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	31719529, 33139352	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11896077, 28550734, 30844427		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17855424, 31147357		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	17855424	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28946212		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	37147304	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14729580, 24722645		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	14729580		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	11233779		★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	17017121	Associate	★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	8394754	Inhibit	★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	27890916		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	39186910	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28778045, 28850077		★☆☆☆☆ Found in Text Mining only
Brain Aneurysm	Brain Aneurysm	BEFREE	29769642		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	15222689		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	12818404		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	LHGDN	12818404		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	19417757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	31191213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	15492293, 15705913, 15901995, 17145829, 17259657, 18340529, 19255063, 19752340, 22427832, 23832257, 23991124, 25703993, 28260049, 31267330		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18340529, 19752340, 23893381, 25703993, 26890638	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	28765242, 28982600, 29336783, 30190273		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	29733693	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25275225		★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	31210423	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23893381, 9174626		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34504150	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14729580, 24722645		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	16829688		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10698479, 10837005, 10971208, 11179831, 11181440, 11794452, 11956078, 12057865, 12111688, 12234692, 12397651, 12432558, 12496042, 12496043, 14626895, 14646692, 15159316, 16170238, 16844322, 17304047, 17337085, 17428572, 17980933, 18420450, 19963114, 21461569, 23832536, 23840365, 23943392, 23943394, 23979979, 24786234, 26323935, 29970677, 9371491		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19962178, 23893381	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34528699	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27197583, 29548309	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15196853, 19962178, 23893381		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28931760		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12694338, 15911707, 16289072, 17854714, 19877306, 22082678, 23624317, 24746542, 24772664, 28322753, 28429955, 28645072, 28685622, 28818791, 29507101, 29581235, 29590135, 30056589, 30076263, 30181855, 30201848, 30300402, 30581333, 30618054, 30797769, 31049900, 31593502, 31846030, 31847538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12694338, 18719109, 19761988, 22219194, 24746542, 34639156, 39456241	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	19326902		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carney Complex	Carney Complex	BEFREE	29017143		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	17161406		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	18280811, 23124356, 28822973		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	29383971	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	25922506		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	15222689		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	28969386	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29041000	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33378050	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	28969386, 30982149		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21407237, 22728010, 24567965, 28429955, 28969386, 29114094, 29255000, 29335483, 29453088, 29618370, 29673284, 30347182, 31822249, 31847538		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28969386, 29769642		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	33631301	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17595772, 25701357, 27197583, 29937309		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	26319155		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17595772, 25701357, 27197583, 29937309		★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	2941193		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11774269, 12041882, 1707229, 19593802, 2170780, 2458150, 29200171, 8394481		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	17763467, 19255975, 29200171		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16979000		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chromosomal Instability	Chromosomal instability	Pubtator	28969386	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	17384005		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12694338, 15068388, 15599890, 15600254, 27127544, 28668952, 28680346, 29854025, 31049900, 31802348		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15068388, 27127544, 28668952, 29362665, 29577973, 29581235, 30278820, 30857306		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19814685, 2165203		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	27013444, 28981149		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17390088, 28596972		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	20364045, 29234752		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28123509		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	15885363, 20673159, 21907168, 28642299, 31134093		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	15675141		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30101704		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20186930, 21350189, 21853095, 23027555, 25574088, 26114600, 26613087, 26971225, 27572454, 27718277, 27754929, 27893428, 28188801, 28189973, 28509629, 28556814, 28601023, 28694747, 28769047, 29116551, 29562280, 29702241, 29871733, 29880739, 30483861, 30539022, 30779979, 31112869, 31391483, 31635441		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	23810507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	20806430	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34183667	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22531693		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18768495, 21425209, 22126566, 26939802, 29540402, 30683126		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	18768495		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22126566, 40003985	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	30968712		★☆☆☆☆ Found in Text Mining only
Congenital absence of spleen	Asplenia	BEFREE	24567965		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10025890, 16675706, 18214807, 19373952, 20732340, 2107368, 2164321		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia, myelofibrosis, nephromegaly syndrome	Congenital Neutropenia, Myelofibrosis, Nephromegaly Syndrome	BEFREE	23738510		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17854714, 29111293, 30372825, 30889221, 31822739		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	31147365		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11479475, 15585878, 18514165, 19651119, 20568015, 23583798, 24036021, 24746542, 26323267, 27422133, 27884085, 28328864, 28404615, 28668952, 28682877, 29473463, 29505607, 29618370, 30219874, 30726210, 30797769		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11479475, 16639078, 18514165, 19651119, 20568015, 23583798, 23620142, 24036021, 24746542, 26323267, 27422133, 27884085, 28328864, 28668952, 28682877, 29473463, 29505607, 29618370, 30219874, 30448568, 30726210, 30797769		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	15006595, 15507760, 18440308		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	19761988, 23818485, 39456241	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	12097534	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18514165, 36180886	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11479475, 18514165, 19651119, 20568015, 23583798, 24036021, 24746542, 24933031, 26323267, 27422133, 27814628, 27884085, 28328864, 28668952, 28682877, 28930526, 29281616, 29473463, 29505607, 29618370, 30219874, 30726210, 30797769		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	40721446	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10563543, 29554272		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34183667	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	30967871		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	29937317	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	15454881, 16883063, 20799947, 28135312, 28278205, 28982600, 29545279, 29937317, 30190273, 30638826, 8805680		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	LHGDN	16883063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	16883063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	22178076, 24885494	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deficiency of butyryl-CoA dehydrogenase	Deficiency Of Butyryl-CoA Dehydrogenase	BEFREE	29618370		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29129008, 29166937		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	19307459, 26631293, 29945876, 30118915, 31814910		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	18042261	Stimulate	★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	29127274		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20471444, 25038328		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	18514165	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27840098, 28212864, 28594010, 30445106, 30697924, 31785385		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31622668		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30967871		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	27171278		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12818404, 12861032, 23384293, 24746542, 28069522, 30181855		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34530062	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12818404, 12861032, 23384293, 24746542, 26360782, 28069522, 29310643, 2941193, 29615288, 30181855, 30244088		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12861032, 19527523, 216438, 23384293, 24746542, 25056433, 26360782	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18667997		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20348234	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21900154	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35069582	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25056433, 29383971	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22248881, 27246625, 27329016		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18280811, 25056433, 27189166, 27796420, 29383971, 29529688, 31355267, 31444563		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	15504976		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	28131839		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	29383971	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	15600254	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15600254, 23268804, 25862415		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	15600254, 18344624		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	23832959		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	27671914, 30005596, 31162936		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17763467		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	15884126		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	LHGDN	15884126		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	15884126	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29618370		★☆☆☆☆ Found in Text Mining only
Ear Diseases	Ear disease	Pubtator	33664381	Stimulate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31622668		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	29138549	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28223911		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	CTD_human_DG	23593274		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29631687		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15299090, 27662901, 28511185		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	27899427, 29564565		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31667656		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	31667656		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19962178		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11434421		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11434421		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37340770	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30539859	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	23124356, 26431910		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	17159117		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	15023809		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28493083		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	33169705	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	22100520, 28358240, 30387131		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	20651370		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12209361, 24882572		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	36011324	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	12135010, 15884126, 29859304		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	12135010		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	14688711	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	17767014, 24083736, 9854050	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	17704068		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	28598286, 30298590, 30626536		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	15756709		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28187981		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38174685	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28187981		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	15025415, 23810690, 25500737, 27365530, 28186568, 28667835, 28878769, 28954887, 29241626, 29315316, 29718465, 29792176, 30131924, 30158055, 30207165, 30278797, 31358739, 31443998, 31476889, 31776158		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	18344624		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	1848489, 29718465, 29792176, 7933836, 8698399	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31726998	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	29792176	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	9848779		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	30207165		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	33664381	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28073648		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	10456969	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	11315931, 27656853, 31719529, 37334358	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	12849060, 23715862, 23810690, 24356554, 27166610, 28339364, 28939882, 29061243, 29447930, 29611345, 29686675, 29693324, 29887327, 30102330, 30338654, 30483978, 30696638, 30805643, 30824651		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	9854050	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	235560		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	20714105	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17854714, 29111293, 30372825, 30889221, 31822739		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	39456241	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	24083736	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	19373952, 7866270		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	LHGDN	15885363		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	29619129	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	35490715	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	11167741, 34319037	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	12800195		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	LHGDN	12800195		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	15885363		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	11376556		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	33139352	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	27759701		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	29548309		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	29548309	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	LHGDN	17875305		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	31581545		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30181855		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	14580687		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28984174, 30944794, 31295384		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23384293, 25394640, 33460291	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23124356, 23384293, 30355911		★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	15885363		★☆☆☆☆ Found in Text Mining only
Hypocomplementemic urticarial vasculitis	Hypocomplementemic Urticarial Vasculitis	BEFREE	30967871		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	31560937		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	31560937	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27581620, 28483502	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	2941193		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29875311, 30856466		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29928060, 31147365, 31675941		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33076992	Associate	★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	29554272		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20699435		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16641309, 30101704, 31585870		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23573303	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24783249, 28286723, 29156761, 29548776, 29973876, 30662664, 31593888		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27840098, 28212864, 28594010, 30445106, 31785385		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28592604, 29620600		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	29718300		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	34611229	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	24391750	Associate	★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	31099890		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	20471444		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	20471444		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	24567965		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	25460734	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	26631964, 28974901		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	17854714		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29041000, 29453088, 29752550, 30414429		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23121609		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	31078922		★☆☆☆☆ Found in Text Mining only
Keratoma	Keratoma	CTD_human_DG	14580687		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	CTD_human_DG	14580687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratosis Blennorrhagica	Keratosis Blennorrhagica	CTD_human_DG	14580687		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15068388, 15161651, 15600254, 17896805, 28580649, 31805271, 9533658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	15161651, 17896805, 22739978, 28187981	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	19913069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	15068388, 15599890, 17521322, 27127544, 28261989, 29318193, 29854025, 31337690		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	12694338	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15600254	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	20623750		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	22739978, 30810341, 31325317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	12694338, 15068388, 15599890, 15600254, 27127544, 28680346, 29854025, 31049900, 31802348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	15068388		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyoma	Leiomyoma	Pubtator	28483502	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10025890, 10456671, 10889907, 11167741, 1708434, 17479404, 19255975, 19666867, 20699435, 2553160, 2821913, 29244249, 3023307, 3864499, 7493141, 8309258, 8383257, 8439949, 8613429, 9326240, 9753066		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1327288, 191121, 2410066, 24344295, 2553160, 26774631, 27974636, 29244249, 3022847, 3031662, 3048438, 35973983, 36930401, 3864499, 6329379, 7517211, 7795240, 9326240, 9662278, 9725460	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17479404		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19666867	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1327288, 14716122, 18687517, 21097707, 21859636, 2790202, 3029127, 8395912, 9326240	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10889907, 10910899, 11473459, 11835327, 12717686, 18256787, 1878594, 19255975, 19672946, 19781775, 22476996, 23325578, 24457336, 2553160, 3031662, 3036278, 3334895, 6329379, 7908235, 8380727, 8613429, 9002966, 9326240, 9662278, 9725460	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19666867	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28244454	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	1327288, 2410066, 3006833, 3031585, 32847610, 9326240	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10391105, 10446492, 10889907, 11840286, 12083944, 1318461, 1382546, 14692523, 15101047, 15510208, 16457884, 17763467, 18256787, 19194466, 19205620, 19672946, 19781775, 20699435, 2165203, 21674360, 24457336, 2542700, 2553160, 27759701, 2811478, 28625325, 28754375, 29067925, 29200171, 29306105, 29541391, 3031662, 3036571, 31358527, 3334895, 7493141, 7517211, 8326735, 8396697, 8483320, 8646738, 8662930, 8980370, 9140287, 9217186, 9326240		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11986950		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	29353699		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19731237, 20673159, 21907168, 22985908, 30774778		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19731237		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15885363, 20673159, 21907168, 28642299, 31134093		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	34504150	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19731237		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	19731237, 23274713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	BEFREE	29138821		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29991758		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	10456969, 16883063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	12432558, 15454881, 16883063, 20799947, 28278205, 29306790, 29545279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	LHGDN	16883063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	CTD_human_DG	23451061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	33076992, 33139352	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28479484		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	12111688		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	12432558, 12496042, 12515618, 16844322, 17304047, 17428572, 17980933		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	23979979, 24786234, 29970677	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	10540169		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11549584, 29588275, 30915077, 33176801, 35958624	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20201986	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37298160	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	10540169		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10540169, 15284296, 17896805, 26573664, 30915077, 31444555, 8162472		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	17896805, 30806732, 31291845		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	LHGDN	17896805		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	17896805	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	37298160	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	10540169		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11001891, 2170780, 28340210, 8395912, 9802341		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31720749		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17149600, 22522002		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18514165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	CTD_human_DG	20471444		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	15492293, 15705913, 15901995, 17145829, 17259657, 18340529, 19255063, 19752340, 22427832, 23832257, 23991124, 25703993, 28260049, 31267330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29631687		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11434421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	10676648, 16829688		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12800195		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10698479, 10837005, 10971208, 11179831, 11181440, 11794452, 11956078, 12057865, 12111688, 12234692, 12397651, 12432558, 12496042, 12496043, 14626895, 14646692, 15159316, 16170238, 16844322, 17304047, 17337085, 17428572, 17980933, 18420450, 19963114, 21461569, 23832536, 23840365, 23943392, 23943394, 23979979, 24786234, 26323935, 29970677, 9371491		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	12111688		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15196853, 23893381		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18205184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18296681, 21461569, 21716162, 21795425, 23535901, 23773345, 27706591		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	21716162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	14580687		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16829688, 17549373, 18505072		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14729580, 24722645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	14729580		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10676648, 11594511, 17479404, 18642288, 19305414, 20418356, 22985908, 23167629, 23991124, 25976379, 26319155, 2673450, 27197583, 27974636, 28552694, 28764808, 29324871, 29331492, 29540402, 30009833, 30662940, 31719821, 31846030		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17595772, 27197583, 29937309		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22531693		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28230705		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	29355552		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	29792176		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	20471444, 25038328		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29382883		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25164947	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24882572, 25164947, 25482861, 30181855, 30201848, 30581334		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	11315931, 24385592	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	28759809		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12861032	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	21071954, 26066543		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	26066543, 36510129	Associate	★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	30891029	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18452102, 19814685		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10430054, 10742562, 10900349, 12810789, 15222689, 17613595, 28511921, 28759809, 29246870, 9307233		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12810789	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15222689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	18042261	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	12810789	Inhibit	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	1333556, 31004030, 9469507		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30334347, 31004030, 36207039, 36399441	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1333556, 6321491, 9326240		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11233779, 2542700		★☆☆☆☆ Found in Text Mining only
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	CLINVAR_DG	15108282, 6260268, 9766845		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	BEFREE	216438, 2462938, 2673450, 29673284, 31002727, 31123149, 31611761, 6297833, 8621627, 9766843		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	ORPHANET_DG	7904599		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	UNIPROT_DG	7904599, 8142659, 8621627, 9354683, 9637725		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myeloperoxidase deficiency	Myeloperoxidase Deficiency	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	GENOMICS_ENGLAND_DG	9637725		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myeloperoxidase Deficiency	Myeloperoxidase Deficiency	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27013444, 28981149		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12615902, 18777087, 19527523, 19543083, 20568015, 28429955, 28645072, 28864169, 29356689, 29544958, 30889221, 31123149		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	16267254, 18314009		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17512353, 22949765, 33410147, 34387532, 35080155	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	8606272	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15585878, 28404615		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	22178076, 32870597	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26849431	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30357493, 31332978		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24340057	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27765067	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30005955		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11181444, 1568230, 16829688, 17804713, 1849601, 22895265, 23991124, 25976379, 28260049, 28743887, 29194117, 29283338, 3023307, 30662940, 31114758, 31301646, 9692553		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	15507759, 31675941, 8162472		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	28514287		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	28514287		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	LHGDN	18344624		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	9033274	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	25500737		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29351721		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	28397206	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25460734	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15255951, 29873817, 30414429, 31175983, 9766843, 9918702		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29983199		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	31719821		★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	35525891	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	23204253		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28358240		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15331175, 16157195, 16195240		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28358240, 30387131		★☆☆☆☆ Found in Text Mining only
Nuchal bleb, familial	Nuchal Bleb	BEFREE	28822973		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16639078, 17145829, 23789921, 27246625, 29577557, 30056589, 30181855, 30581334, 31822739		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19390527, 25388404, 25394640	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19729473, 24455214, 25703993	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22401873	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	37085667	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30304126		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17483704		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	29342044, 30570611		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	27166750		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28429863		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15196853, 23893381		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23893381, 27531373	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	30134811		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18205184		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18205184		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18205184	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	CTD_human_DG	16440434		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	29269298, 31274831, 31433214		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancytopenia	Pancytopenia	BEFREE	8795690		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16014720, 26137956, 27650074, 28466093, 29217173, 31175983		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	31099890		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	12849060, 24356554		★☆☆☆☆ Found in Text Mining only
Pelger-Huet Anomaly	Pelger-Huet Anomaly	BEFREE	29545424		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	19147137	Stimulate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	17451207	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	11960308, 23501330, 28984174		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27666673, 28504459, 28555944, 29516514, 29680842, 29876665, 29972696, 30298590, 30304126, 31355267		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	19651670, 38172197	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21950958		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31385079		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31385079		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	21950958		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	28362977, 28412475		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	11149660		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28598286		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	25301710, 28188801		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25053723, 28340210, 8395912		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	8395912		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1707229, 19593802, 2166608, 2458150, 28340210, 29244249, 3031662, 8152261, 8955614, 9140287, 9802341		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	2166608, 8618442		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	15023809		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29180269		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18296681, 21461569, 21716162, 21795425, 23535901, 23773345, 27706591		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18296681		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18296681, 21716162, 21795425, 23535901, 27706591	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	21716162		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Protanomaly	Protanomaly	BEFREE	15101047		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	30134811		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	32758448, 36011324	Associate	★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	20471444		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29875311		★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	16883063, 30190273		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22701684, 23794464, 32383462	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37935721	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	31651292		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30207165, 31675941		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	20636397, 21658319	Stimulate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	28981149, 30967871		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	25038328		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	26364660, 28398552		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30565999		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	28580649		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28261989, 29318193		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	28596972		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28709648, 29212955, 29253353, 31013737, 31841990		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	19897513	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	16883063, 27928450	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	29260199, 31266060		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	31266060	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	22450443, 26001728		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22767531, 24928093, 26364660, 27483410, 28124760, 28398552, 28511921, 29129008, 30789095, 31284792, 31430907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	37147304	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	39940697	Inhibit	★☆☆☆☆ Found in Text Mining only
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	30967871		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30106367		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	11087769, 16484808, 30689571, 9918702		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	29212955, 35681439, 37261353	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11593004, 17854714, 21883476, 26949091, 27613897, 28167245, 28694565, 29212955, 29243040, 29301654, 29394241, 29484685, 29520957, 29540208, 29549730, 30005596, 30120096, 30134811, 30340097, 30630473, 31325317, 31817302		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	33408719, 35854322	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	32758448, 34669971	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	14580687		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33378050	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12432558		★☆☆☆☆ Found in Text Mining only
Small vessel vasculitis	Small vessel vasculitis	BEFREE	10337034, 12027420, 14678279, 16557221, 26033562, 28495147, 29686675, 30207165		★☆☆☆☆ Found in Text Mining only
Specific granule deficiency	Specific Granule Deficiency	BEFREE	2536400		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 11	Spinocerebellar ataxia	Pubtator	29619129	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	34880852	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12397651, 23979979		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29296528, 30539859		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	29630749		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	12397651, 16195240		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	24695986, 27988513, 28704420, 29894287, 31615411		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30592708		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28358240, 29680842, 30926484		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16829688, 17549373, 18505072		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16829688		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18505072, 29331492	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	35563254	Inhibit	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21407237, 28969386	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	25922506, 28342702, 29133197, 29162556, 30910642, 31590996		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28861174		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	20636397, 27082547	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30113066		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30106367, 31776158		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	21071954		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22059534	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29473463		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25301710, 29894287, 37857225	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	27928450, 33410147	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34325712	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37705974	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	9246211	Associate	★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	BEFREE	29931487		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	20380826, 22119283, 24055189		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	21221801, 21425209, 28781623, 28845184, 28922365, 29407223, 29530609, 29710547, 30554117, 30797423, 30906449, 31524230		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	18514165		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	31629808		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24722645	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29267235, 34549902, 40430030	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19322015		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	18204966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17595772, 27197583	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	20651370		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	31783639		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	15304260		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15599890, 15911707, 21950958, 31593502		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	15625114	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	24746542	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	10337034, 10498622, 10607485, 10792617, 12027420, 12685871, 12722027, 12849060, 12858454, 14740428, 14740429, 15025415, 15507759, 15675141, 15895894, 17521322, 18181035, 18806928, 19264905, 19690440, 20714105, 21071954, 22861362, 23832959, 23985571, 25060059, 26033562, 26443607, 27166610, 27320904, 27365530, 27752292, 27755177, 28138552, 28339364, 28361331, 28391344, 28842398, 29318193, 29342044, 29390440, 29395165, 29447930, 29673090, 29707909, 29790303, 30158055, 30239910, 30279272, 30404113, 30696638, 30795559, 30923957, 31088509, 31181198, 31362703, 31371653, 31372719, 31383567, 31476889, 31552433, 31719144, 31772138, 31781107, 7579414, 8162472, 8698399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	Pubtator	10691933, 1664417, 25060059, 27166610, 27752292, 28939882, 31790283, 32282021, 32734361, 33076992, 33664381, 37004177, 37331172, 37866310, 38056010, 39186910, 7579414, 8536374, 8698399, 9933467	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	LHGDN	15507759, 15507770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thromboembolism	Venous thromboembolism	Pubtator	32781781	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34449018	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	28404615		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	33410147	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	33410147	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19758957		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19758957		★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	35525891	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	30042310		★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	20651370		★☆☆☆☆ Found in Text Mining only