MPC1L (mitochondrial pyruvate carrier 1 like)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 347411
Gene name Mitochondrial pyruvate carrier 1 like
Gene symbol MPC1L
Synonyms (NCBI Gene)
SLC54A3
Chromosome X
Chromosome location Xp11.4
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 35278701
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IBA
GO:0005743 Component Mitochondrial inner membrane IDA 27317664
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301103 44205 ENSG00000238205
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DKB6
Protein name Mitochondrial pyruvate carrier 1-like protein
Protein function Mediates the uptake of pyruvate into mitochondria.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03650 MPC 11 → 121 Mitochondrial pyruvate carriers Family
Sequence 
MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTA
LILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPAT
AAAATSPGSQPPKQAS
Sequence length 136
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Diabetic cardiomyopathy

No strongly related genes found yet for MPC1L.

No additional diseases found yet through genes similar to MPC1L.