MOSPD3 (motile sperm domain containing 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 64598
Gene name Motile sperm domain containing 3
Gene symbol MOSPD3
Synonyms (NCBI Gene)
CDS3NET30
Chromosome 7
Chromosome location 7q22.1
Summary This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding diff
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019822 hsa-miR-375 Microarray 20215506
MIRT039297 hsa-miR-671-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0007507 Process Heart development IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609125 25078 ENSG00000106330
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75425
Protein name Motile sperm domain-containing protein 3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00635 Motile_Sperm 33 → 131 MSP (Major sperm protein) domain Domain
Sequence 
MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNP
TGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEG
AEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSS
FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT
Sequence length 235
Interactions View interactions

No strongly related genes found yet for MOSPD3.

No additional diseases found yet through genes similar to MOSPD3.