Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	346606
Gene name	Monoacylglycerol O-acyltransferase 3
Gene symbol	MOGAT3
Synonyms (NCBI Gene)	DC7DGAT2L2MGAT3
Chromosome	7
Chromosome location	7q22.1
Summary	Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM, Mar 2008]

21 Show/Hide all (21)

miRTarBase ID	miRNA	Experiments
MIRT2044383	hsa-miR-128	CLIP-seq
MIRT2044384	hsa-miR-1293	CLIP-seq
MIRT2044385	hsa-miR-148a	CLIP-seq
MIRT2044386	hsa-miR-148b	CLIP-seq
MIRT2044387	hsa-miR-152	CLIP-seq
MIRT2044388	hsa-miR-4264	CLIP-seq
MIRT2044389	hsa-miR-4483	CLIP-seq
MIRT2044390	hsa-miR-4797-3p	CLIP-seq
MIRT2044391	hsa-miR-515-3p	CLIP-seq
MIRT2044392	hsa-miR-519e	CLIP-seq
MIRT2044383	hsa-miR-128	CLIP-seq
MIRT2273655	hsa-miR-1289	CLIP-seq
MIRT2044384	hsa-miR-1293	CLIP-seq
MIRT2273656	hsa-miR-3198	CLIP-seq
MIRT2273657	hsa-miR-4294	CLIP-seq
MIRT2273658	hsa-miR-4309	CLIP-seq
MIRT2044389	hsa-miR-4483	CLIP-seq
MIRT2454380	hsa-miR-1208	CLIP-seq
MIRT2454381	hsa-miR-3646	CLIP-seq
MIRT2454382	hsa-miR-3663-5p	CLIP-seq
MIRT2454383	hsa-miR-892a	CLIP-seq

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IDA	27184406
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IEA
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	TAS
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IBA
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IDA	27184406
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	27184406
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006071	Process	Glycerol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006640	Process	Monoacylglycerol biosynthetic process	IDA	28420705
GO:0008374	Function	O-acyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IBA
GO:0019432	Process	Triglyceride biosynthetic process	IDA	27184406
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019432	Process	Triglyceride biosynthetic process	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:1990578	Component	Perinuclear endoplasmic reticulum membrane	IDA	27184406

MIM	HGNC	e!Ensembl
610184	23249	ENSG00000106384

Q86VF5

Protein name

2-acylglycerol O-acyltransferase 3 (EC 2.3.1.20) (EC 2.3.1.22) (Acyl-CoA:monoacylglycerol acyltransferase 3) (MGAT3) (Diacylglycerol O-acyltransferase candidate 7) (hDC7) (Diacylglycerol acyltransferase 2-like protein 7) (Monoacylglycerol O-acyltransferas

Protein function

Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoy

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03982	DAGAT	45 → 341	Diacylglycerol acyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level

Sequence

MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYL
VWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMC
TGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQ
PQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRL
KAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR
LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI

Sequence length

341

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycerolipid metabolism	Triglyceride biosynthesis
Metabolic pathways
Fat digestion and absorption

MOGAT3 (monoacylglycerol O-acyltransferase 3)

Bookmark This Gene