MOB3B (MOB kinase activator 3B)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79817
• Gene name: MOB kinase activator 3B
• Gene symbol: MOB3B
• Synonyms (NCBI Gene): C9orf35, MOB1D, MOBKL2B
• Chromosome: 9
• Chromosome location: 9p21.2
• Summary: The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the inte

miRNA Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021972	hsa-miR-128-3p	Microarray	17612493
MIRT023324	hsa-miR-122-5p	Microarray	17612493
MIRT025174	hsa-miR-181a-5p	Microarray	17612493
MIRT027623	hsa-miR-98-5p	Microarray	19088304
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT442534	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT442533	hsa-miR-455-5p	PAR-CLIP	22100165
MIRT442532	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT442531	hsa-miR-6875-3p	PAR-CLIP	22100165
MIRT442530	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT442529	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT734440	hsa-miR-495-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, Western blotting	33087165
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT442534	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT442533	hsa-miR-455-5p	PAR-CLIP	22100165
MIRT442532	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT442531	hsa-miR-6875-3p	PAR-CLIP	22100165
MIRT442530	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT442529	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0035330	Process	Regulation of hippo signaling	IMP	28792927
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 617652
• HGNC: 23825
• e!Ensembl: ENSG00000120162

Protein

• UniProt ID: Q86TA1
• Protein name: MOB kinase activator 3B (Mob1 homolog 2b) (Mps one binder kinase activator-like 2B) (MOB kinase activator-like 2B)
• Protein function: Modulates LATS1 expression in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03637	Mob1_phocein	35 → 207	Mob1/phocein family	Family

• Sequence:

  MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWV
  AVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNL
  LMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEA
  HVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH

• Sequence length: 216

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35694926	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	25442119	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	27611488	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM OF EYE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	35694926	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	37492107	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	34475377, 37979250	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC ANEMIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34782712	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	29559693	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	29559693	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	29559693	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	40210677	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (10)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASDB_DG	20801717, 20801718, 23587638		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23141412		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	23587638, 34475377	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASCAT_DG	25442119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	35381768	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	34475377, 37979250	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23918943		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	23376709		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26130958, 28084441, 30866497	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	36232302	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RAB38 2 shared diseasesEye neoplasms, Frontotemporal dementia 2 shared evidence sourcesGWAS catalog (Eye neoplasms), GWAS catalog (Frontotemporal dementia) Related via 2 shared diseases including Eye neoplasms, Frontotemporal dementia — evidence mostly GWAS catalog. SEM1 2 shared diseasesDiverticular disease, Frontotemporal dementia 2 shared evidence sourcesGWAS catalog (Diverticular disease), GWAS catalog (Frontotemporal dementia) Related via 2 shared diseases including Diverticular disease, Frontotemporal dementia — evidence mostly GWAS catalog. G2E3 1 shared diseaseFrontotemporal dementia 2 shared evidence sourcesGWAS catalog (Amyotrophic lateral sclerosis), GWAS catalog (Frontotemporal dementia) Related via 1 shared disease including Frontotemporal dementia — evidence mostly GWAS catalog. SLC39A11 1 shared diseaseDiverticular disease 2 shared evidence sourcesGWAS catalog (Amyotrophic lateral sclerosis), GWAS catalog (Diverticular disease) Related via 1 shared disease including Diverticular disease — evidence mostly GWAS catalog. TSPAN9 1 shared diseaseDiverticular disease 2 shared evidence sourcesGWAS catalog (Amyotrophic lateral sclerosis), GWAS catalog (Diverticular disease) Related via 1 shared disease including Diverticular disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RAB38	2	["Eye neoplasms","Frontotemporal dementia"]	0	[]	2	["GWAS catalog (Eye neoplasms)","GWAS catalog (Frontotemporal dementia)"]
SEM1	2	["Diverticular disease","Frontotemporal dementia"]	0	[]	2	["GWAS catalog (Diverticular disease)","GWAS catalog (Frontotemporal dementia)"]
G2E3	1	["Frontotemporal dementia"]	0	[]	2	["GWAS catalog (Amyotrophic lateral sclerosis)","GWAS catalog (Frontotemporal dementia)"]
SLC39A11	1	["Diverticular disease"]	0	[]	2	["GWAS catalog (Amyotrophic lateral sclerosis)","GWAS catalog (Diverticular disease)"]
TSPAN9	1	["Diverticular disease"]	0	[]	2	["GWAS catalog (Amyotrophic lateral sclerosis)","GWAS catalog (Diverticular disease)"]

Diseases Linked via Similar Genes

Central nervous system cancer Linked via 2 of 5 related genesSEM1, TSPAN9 Glioblastoma Linked via 2 of 5 related genesSEM1, TSPAN9 Glioma Linked via 2 of 5 related genesSEM1, TSPAN9 Oligodendroglioma Linked via 2 of 5 related genesSEM1, TSPAN9 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesSEM1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Central nervous system cancer	2	["SEM1","TSPAN9"]
Glioblastoma	2	["SEM1","TSPAN9"]
Glioma	2	["SEM1","TSPAN9"]
Oligodendroglioma	2	["SEM1","TSPAN9"]
Attention deficit hyperactivity disorder	1	["SEM1"]