MMP28 (matrix metallopeptidase 28)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79148
• Gene name: Matrix metallopeptidase 28
• Gene symbol: MMP28
• Synonyms (NCBI Gene): EPILYSIN, MM28, MMP-25, MMP-28, MMP25
• Chromosome: 17
• Chromosome location: 17q12
• Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction and tissue remodeling, and disease processes, such as asthma a

miRNA Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1153503	hsa-miR-3617	CLIP-seq
MIRT1153504	hsa-miR-384	CLIP-seq
MIRT1153505	hsa-miR-641	CLIP-seq
MIRT1153506	hsa-miR-125a-5p	CLIP-seq
MIRT1153507	hsa-miR-125b	CLIP-seq
MIRT1153508	hsa-miR-146b-3p	CLIP-seq
MIRT1153509	hsa-miR-29a	CLIP-seq
MIRT1153510	hsa-miR-29b	CLIP-seq
MIRT1153511	hsa-miR-29c	CLIP-seq
MIRT1153512	hsa-miR-3157-3p	CLIP-seq
MIRT1153513	hsa-miR-3173-5p	CLIP-seq
MIRT1153514	hsa-miR-3663-3p	CLIP-seq
MIRT1153515	hsa-miR-4319	CLIP-seq
MIRT1153516	hsa-miR-4324	CLIP-seq
MIRT1153517	hsa-miR-874	CLIP-seq
MIRT2454323	hsa-miR-4323	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC1	Repression	20144149
SP1	Unknown	11574168

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	11121398, 11255011
GO:0005515	Function	Protein binding	IPI	21152186, 28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010760	Process	Negative regulation of macrophage chemotaxis	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0031012	Component	Extracellular matrix	HDA	27068509
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	NAS	11121398
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 608417
• HGNC: 14366
• e!Ensembl: ENSG00000271447

Protein

• UniProt ID: Q9H239
• Protein name: Matrix metalloproteinase-28 (MMP-28) (EC 3.4.24.-) (Epilysin)
• Protein function: Can degrade casein. Could play a role in tissues homeostasis and repair.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00045	Hemopexin	375 → 416	Hemopexin	Repeat
  PF00045	Hemopexin	328 → 371	Hemopexin	Repeat
  PF00413	Peptidase_M10	129 → 284	Matrixin	Domain
  PF01471	PG_binding_1	30 → 86	Putative peptidoglycan binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in testes and lung. Low levels are detected in kidney, pancreas and skin. Also expressed in fetal lung, brain, skeletal muscle and kidney. Expressed selectively in keratinocytes. Widely expressed in several car
• Sequence:

  MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFS
  DAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRK
  KRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
  IRLTFFQGDHNDGLGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAH
  EIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLF
  TDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPR
  PLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDA
  ALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFF
  RDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF

• Sequence length: 520

Related Genes

No strongly related genes found yet for MMP28.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MMP28.