MMP2 (matrix metallopeptidase 2)

Gene

• Entrez ID: 4313
• Gene name: Matrix metallopeptidase 2
• Gene symbol: MMP2
• Synonyms (NCBI Gene): CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1
• Chromosome: 16
• Chromosome location: 16q12.2
• Summary: This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelati

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs41459945	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs121912953	G>A	Pathogenic	Coding sequence variant, missense variant
rs121912954	C>A,G	Pathogenic	Coding sequence variant, stop gained
rs121912955	G>A	Pathogenic	Coding sequence variant, missense variant
rs140172728	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, coding sequence variant
rs148801200	C>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, synonymous variant
rs786205497	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs794727275	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs794727916	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1567378779	C>-	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	20657750
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	20657750
MIRT005742	hsa-miR-451a	qRT-PCR, Western blot	20816946
MIRT005570	hsa-miR-29b-3p	Western blot	23254643
MIRT018099	hsa-miR-335-5p	Microarray	18185580
MIRT019228	hsa-miR-338-3p	Western blot;qRT-PCR	21671467
MIRT030716	hsa-miR-21-5p	qRT-PCR	19435867
MIRT031370	hsa-miR-17-5p	Western blot	20209605
MIRT005570	hsa-miR-29b-3p	Western blot	24130681
MIRT053245	hsa-miR-29c-3p	qRT-PCR, Western blot	23175151
MIRT053336	hsa-miR-491-5p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	23725476
MIRT053481	hsa-miR-9-5p	qRT-PCR	21931274
MIRT053580	hsa-miR-29a-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053580	hsa-miR-29a-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT005570	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT005570	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053245	hsa-miR-29c-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT053245	hsa-miR-29c-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24130168
MIRT005570	hsa-miR-29b-3p	Microarray	22942087
MIRT053787	hsa-miR-452-5p	Microarray, qRT-PCR	22952876
MIRT437388	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT053580	hsa-miR-29a-3p	Luciferase reporter assay	22745231
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay	22745231
MIRT053245	hsa-miR-29c-3p	Luciferase reporter assay	22745231
MIRT437572	hsa-miR-767-5p	Luciferase reporter assay	22745231
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT005570	hsa-miR-29b-3p	Western blot	24147037
MIRT438234	hsa-miR-221-3p	Western blot	24147037
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT053245	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23936390
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT005570	hsa-miR-29b-3p	Western blot	24147037
MIRT438234	hsa-miR-221-3p	Western blot	24147037
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT053245	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23936390
MIRT724938	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT724937	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT724936	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT724935	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT724934	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724933	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT440222	hsa-miR-544a	HITS-CLIP	24374217
MIRT440222	hsa-miR-544a	HITS-CLIP	24374217
MIRT731061	hsa-miR-130b-3p	qRT-PCR, Luciferase reporter assay, Western blot	25154741
MIRT731061	hsa-miR-130b-3p	qRT-PCR, Luciferase reporter assay, Western blot	25154741
MIRT731453	hsa-miR-125b-5p	Luciferase reporter assay	27133077
MIRT731453	hsa-miR-125b-5p	Luciferase reporter assay	27133077
MIRT053580	hsa-miR-29a-3p	Luciferase reporter assay	26700017
MIRT005742	hsa-miR-451a	qRT-PCR, Western blot	27173190
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26063204
MIRT732484	hsa-miR-20a-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33788053
MIRT732713	hsa-miR-34a-5p	qRT-PCR	33773546
MIRT732990	hsa-miR-1237-3p	Microarray	33435900
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR	32699607
MIRT019228	hsa-miR-338-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33817311
MIRT732484	hsa-miR-20a-3p	Western blotting, Immunoprecipitaion (IP), qRT-PCR	33788053
MIRT737478	hsa-miR-200a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31772330
MIRT724938	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT724937	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT724936	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT724935	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT724934	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724933	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT755535	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755915	hsa-miR-145-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35722425
MIRT756341	hsa-miR-518a-5p	Western blotting, qRT-PCR	37132750
MIRT756431	hsa-miR-146a-5p	qRT-PCR	36415628
MIRT756466	hsa-miR-182-5p	qRT-PCR	38796528
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT1153362	hsa-miR-3944-5p	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT1153365	hsa-miR-3921	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT1153367	hsa-miR-4649-3p	CLIP-seq
MIRT1153368	hsa-miR-4653-5p	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT2043917	hsa-miR-765	CLIP-seq
MIRT2273303	hsa-miR-29a	CLIP-seq
MIRT2273304	hsa-miR-29b	CLIP-seq
MIRT2273305	hsa-miR-29c	CLIP-seq
MIRT2273306	hsa-miR-3065-3p	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2273307	hsa-miR-4436b-3p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT2273308	hsa-miR-4690-3p	CLIP-seq
MIRT2273309	hsa-miR-4733-3p	CLIP-seq
MIRT2431185	hsa-miR-106a	CLIP-seq
MIRT2431186	hsa-miR-106b	CLIP-seq
MIRT2431187	hsa-miR-124	CLIP-seq
MIRT2431188	hsa-miR-17	CLIP-seq
MIRT2431189	hsa-miR-20a	CLIP-seq
MIRT2431190	hsa-miR-20b	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2431193	hsa-miR-3202	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2431194	hsa-miR-3616-5p	CLIP-seq
MIRT2431195	hsa-miR-3647-5p	CLIP-seq
MIRT2431196	hsa-miR-3688-5p	CLIP-seq
MIRT2431197	hsa-miR-3714	CLIP-seq
MIRT2431198	hsa-miR-3910	CLIP-seq
MIRT2431199	hsa-miR-4263	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2431201	hsa-miR-4293	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT2431202	hsa-miR-4519	CLIP-seq
MIRT2431203	hsa-miR-4521	CLIP-seq
MIRT2431204	hsa-miR-4530	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT2431205	hsa-miR-4716-3p	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2431207	hsa-miR-4747-5p	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2431209	hsa-miR-4795-5p	CLIP-seq
MIRT2431210	hsa-miR-506	CLIP-seq
MIRT2431211	hsa-miR-519a	CLIP-seq
MIRT2431212	hsa-miR-519b-3p	CLIP-seq
MIRT2431213	hsa-miR-519c-3p	CLIP-seq
MIRT2431214	hsa-miR-519d	CLIP-seq
MIRT2431215	hsa-miR-520d-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT2431217	hsa-miR-573	CLIP-seq
MIRT2431218	hsa-miR-595	CLIP-seq
MIRT2431219	hsa-miR-625	CLIP-seq
MIRT2431220	hsa-miR-644	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT2431221	hsa-miR-885-3p	CLIP-seq
MIRT2431222	hsa-miR-93	CLIP-seq
MIRT2438718	hsa-miR-1207-5p	CLIP-seq
MIRT2438719	hsa-miR-1238	CLIP-seq
MIRT2438720	hsa-miR-1253	CLIP-seq
MIRT2438721	hsa-miR-1273f	CLIP-seq
MIRT2438722	hsa-miR-1321	CLIP-seq
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT2438723	hsa-miR-136	CLIP-seq
MIRT2438724	hsa-miR-143	CLIP-seq
MIRT2438725	hsa-miR-1587	CLIP-seq
MIRT2438726	hsa-miR-1825	CLIP-seq
MIRT2438727	hsa-miR-199a-3p	CLIP-seq
MIRT2438728	hsa-miR-199a-5p	CLIP-seq
MIRT2438729	hsa-miR-199b-3p	CLIP-seq
MIRT2438730	hsa-miR-199b-5p	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT2438731	hsa-miR-299-3p	CLIP-seq
MIRT2438732	hsa-miR-3129-5p	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2438733	hsa-miR-3184	CLIP-seq
MIRT2438734	hsa-miR-34c-3p	CLIP-seq
MIRT1153362	hsa-miR-3944-5p	CLIP-seq
MIRT2438735	hsa-miR-423-5p	CLIP-seq
MIRT2438736	hsa-miR-4265	CLIP-seq
MIRT2438737	hsa-miR-4270	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2438738	hsa-miR-4296	CLIP-seq
MIRT2438739	hsa-miR-4322	CLIP-seq
MIRT2438740	hsa-miR-4417	CLIP-seq
MIRT2438741	hsa-miR-4434	CLIP-seq
MIRT2438742	hsa-miR-4441	CLIP-seq
MIRT2438743	hsa-miR-4446-3p	CLIP-seq
MIRT2438744	hsa-miR-4491	CLIP-seq
MIRT2438745	hsa-miR-4492	CLIP-seq
MIRT2438746	hsa-miR-4498	CLIP-seq
MIRT2438747	hsa-miR-4516	CLIP-seq
MIRT2438748	hsa-miR-4531	CLIP-seq
MIRT2438749	hsa-miR-4639-5p	CLIP-seq
MIRT2438750	hsa-miR-4656	CLIP-seq
MIRT2438751	hsa-miR-4657	CLIP-seq
MIRT2438752	hsa-miR-4663	CLIP-seq
MIRT2438753	hsa-miR-4675	CLIP-seq
MIRT2438754	hsa-miR-4677-3p	CLIP-seq
MIRT2438755	hsa-miR-4679	CLIP-seq
MIRT2438756	hsa-miR-4688	CLIP-seq
MIRT2438757	hsa-miR-4708-5p	CLIP-seq
MIRT2438758	hsa-miR-4711-3p	CLIP-seq
MIRT2438759	hsa-miR-4721	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2438760	hsa-miR-4728-5p	CLIP-seq
MIRT2438761	hsa-miR-4739	CLIP-seq
MIRT2438762	hsa-miR-4741	CLIP-seq
MIRT2438763	hsa-miR-4755-3p	CLIP-seq
MIRT2438764	hsa-miR-4756-5p	CLIP-seq
MIRT2438765	hsa-miR-4763-3p	CLIP-seq
MIRT2438766	hsa-miR-4770	CLIP-seq
MIRT2438767	hsa-miR-4786-3p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2438768	hsa-miR-4797-3p	CLIP-seq
MIRT2438769	hsa-miR-485-3p	CLIP-seq
MIRT2438770	hsa-miR-486-3p	CLIP-seq
MIRT2438771	hsa-miR-511	CLIP-seq
MIRT2438772	hsa-miR-562	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT2438773	hsa-miR-664	CLIP-seq
MIRT2438774	hsa-miR-671-5p	CLIP-seq
MIRT2438775	hsa-miR-762	CLIP-seq
MIRT2438776	hsa-miR-936	CLIP-seq
MIRT2431185	hsa-miR-106a	CLIP-seq
MIRT2431186	hsa-miR-106b	CLIP-seq
MIRT2572098	hsa-miR-1179	CLIP-seq
MIRT2572099	hsa-miR-1206	CLIP-seq
MIRT2438718	hsa-miR-1207-5p	CLIP-seq
MIRT2572100	hsa-miR-122	CLIP-seq
MIRT2572101	hsa-miR-1227	CLIP-seq
MIRT2572102	hsa-miR-1237	CLIP-seq
MIRT2438719	hsa-miR-1238	CLIP-seq
MIRT2431187	hsa-miR-124	CLIP-seq
MIRT2572103	hsa-miR-1244	CLIP-seq
MIRT2572104	hsa-miR-1248	CLIP-seq
MIRT2572105	hsa-miR-1251	CLIP-seq
MIRT2438720	hsa-miR-1253	CLIP-seq
MIRT2438721	hsa-miR-1273f	CLIP-seq
MIRT2572106	hsa-miR-1276	CLIP-seq
MIRT2572107	hsa-miR-1299	CLIP-seq
MIRT2438722	hsa-miR-1321	CLIP-seq
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT2438723	hsa-miR-136	CLIP-seq
MIRT2572108	hsa-miR-139-5p	CLIP-seq
MIRT2438724	hsa-miR-143	CLIP-seq
MIRT2572109	hsa-miR-146b-3p	CLIP-seq
MIRT2572110	hsa-miR-1470	CLIP-seq
MIRT2572111	hsa-miR-1538	CLIP-seq
MIRT2438725	hsa-miR-1587	CLIP-seq
MIRT2431188	hsa-miR-17	CLIP-seq
MIRT2438726	hsa-miR-1825	CLIP-seq
MIRT2572112	hsa-miR-190	CLIP-seq
MIRT2572113	hsa-miR-190b	CLIP-seq
MIRT2572114	hsa-miR-1914	CLIP-seq
MIRT2438728	hsa-miR-199a-5p	CLIP-seq
MIRT2438730	hsa-miR-199b-5p	CLIP-seq
MIRT2431189	hsa-miR-20a	CLIP-seq
MIRT2431190	hsa-miR-20b	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT2572115	hsa-miR-2909	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT2438731	hsa-miR-299-3p	CLIP-seq
MIRT2273303	hsa-miR-29a	CLIP-seq
MIRT2273304	hsa-miR-29b	CLIP-seq
MIRT2273305	hsa-miR-29c	CLIP-seq
MIRT2572116	hsa-miR-302f	CLIP-seq
MIRT2572117	hsa-miR-3064-3p	CLIP-seq
MIRT2273306	hsa-miR-3065-3p	CLIP-seq
MIRT2572118	hsa-miR-3065-5p	CLIP-seq
MIRT2572119	hsa-miR-3125	CLIP-seq
MIRT2572120	hsa-miR-3127-5p	CLIP-seq
MIRT2572121	hsa-miR-3148	CLIP-seq
MIRT2572122	hsa-miR-3156-3p	CLIP-seq
MIRT2572123	hsa-miR-3160-3p	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT2572124	hsa-miR-3168	CLIP-seq
MIRT2572125	hsa-miR-3173-5p	CLIP-seq
MIRT2572126	hsa-miR-3177-3p	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2572127	hsa-miR-3181	CLIP-seq
MIRT2572128	hsa-miR-3182	CLIP-seq
MIRT2438733	hsa-miR-3184	CLIP-seq
MIRT2572129	hsa-miR-3185	CLIP-seq
MIRT2572130	hsa-miR-3187-3p	CLIP-seq
MIRT2572131	hsa-miR-3192	CLIP-seq
MIRT2431193	hsa-miR-3202	CLIP-seq
MIRT2572132	hsa-miR-326	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2572133	hsa-miR-330-5p	CLIP-seq
MIRT2572134	hsa-miR-339-5p	CLIP-seq
MIRT2438734	hsa-miR-34c-3p	CLIP-seq
MIRT2572135	hsa-miR-3611	CLIP-seq
MIRT2431194	hsa-miR-3616-5p	CLIP-seq
MIRT2572136	hsa-miR-3622a-5p	CLIP-seq
MIRT2572137	hsa-miR-3647-3p	CLIP-seq
MIRT2431195	hsa-miR-3647-5p	CLIP-seq
MIRT2572138	hsa-miR-3667-5p	CLIP-seq
MIRT2572139	hsa-miR-3672	CLIP-seq
MIRT2572140	hsa-miR-3675-3p	CLIP-seq
MIRT2572141	hsa-miR-3677-5p	CLIP-seq
MIRT2431196	hsa-miR-3688-5p	CLIP-seq
MIRT2572142	hsa-miR-3689a-3p	CLIP-seq
MIRT2572143	hsa-miR-3689c	CLIP-seq
MIRT2431197	hsa-miR-3714	CLIP-seq
MIRT2572144	hsa-miR-371b-3p	CLIP-seq
MIRT2572145	hsa-miR-376c	CLIP-seq
MIRT2431198	hsa-miR-3910	CLIP-seq
MIRT2572146	hsa-miR-3916	CLIP-seq
MIRT2572147	hsa-miR-3918	CLIP-seq
MIRT2572148	hsa-miR-3920	CLIP-seq
MIRT1153365	hsa-miR-3921	CLIP-seq
MIRT2572149	hsa-miR-3925-3p	CLIP-seq
MIRT2572150	hsa-miR-3973	CLIP-seq
MIRT2438735	hsa-miR-423-5p	CLIP-seq
MIRT2431199	hsa-miR-4263	CLIP-seq
MIRT2438736	hsa-miR-4265	CLIP-seq
MIRT2438737	hsa-miR-4270	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2572151	hsa-miR-4278	CLIP-seq
MIRT2572152	hsa-miR-4289	CLIP-seq
MIRT2572153	hsa-miR-4290	CLIP-seq
MIRT2431201	hsa-miR-4293	CLIP-seq
MIRT2438738	hsa-miR-4296	CLIP-seq
MIRT2572154	hsa-miR-4301	CLIP-seq
MIRT2572155	hsa-miR-4310	CLIP-seq
MIRT2572156	hsa-miR-4311	CLIP-seq
MIRT2438739	hsa-miR-4322	CLIP-seq
MIRT2438740	hsa-miR-4417	CLIP-seq
MIRT2572157	hsa-miR-4422	CLIP-seq
MIRT2572158	hsa-miR-4428	CLIP-seq
MIRT2438741	hsa-miR-4434	CLIP-seq
MIRT2572159	hsa-miR-4436a	CLIP-seq
MIRT2273307	hsa-miR-4436b-3p	CLIP-seq
MIRT2438742	hsa-miR-4441	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT2438743	hsa-miR-4446-3p	CLIP-seq
MIRT2438744	hsa-miR-4491	CLIP-seq
MIRT2438745	hsa-miR-4492	CLIP-seq
MIRT2572160	hsa-miR-4493	CLIP-seq
MIRT2438746	hsa-miR-4498	CLIP-seq
MIRT2438747	hsa-miR-4516	CLIP-seq
MIRT2431202	hsa-miR-4519	CLIP-seq
MIRT2572161	hsa-miR-452	CLIP-seq
MIRT2431203	hsa-miR-4521	CLIP-seq
MIRT2572162	hsa-miR-4525	CLIP-seq
MIRT2572163	hsa-miR-4529-5p	CLIP-seq
MIRT2431204	hsa-miR-4530	CLIP-seq
MIRT2438748	hsa-miR-4531	CLIP-seq
MIRT2572164	hsa-miR-4639-3p	CLIP-seq
MIRT2438749	hsa-miR-4639-5p	CLIP-seq
MIRT2572165	hsa-miR-4645-5p	CLIP-seq
MIRT1153367	hsa-miR-4649-3p	CLIP-seq
MIRT2572166	hsa-miR-4651	CLIP-seq
MIRT1153368	hsa-miR-4653-5p	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT2438750	hsa-miR-4656	CLIP-seq
MIRT2438751	hsa-miR-4657	CLIP-seq
MIRT2438752	hsa-miR-4663	CLIP-seq
MIRT2572167	hsa-miR-4673	CLIP-seq
MIRT2438753	hsa-miR-4675	CLIP-seq
MIRT2572168	hsa-miR-4676-3p	CLIP-seq
MIRT2438754	hsa-miR-4677-3p	CLIP-seq
MIRT2438755	hsa-miR-4679	CLIP-seq
MIRT2572169	hsa-miR-4684-5p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT2438756	hsa-miR-4688	CLIP-seq
MIRT2273308	hsa-miR-4690-3p	CLIP-seq
MIRT2572170	hsa-miR-4693-5p	CLIP-seq
MIRT2572171	hsa-miR-4700-3p	CLIP-seq
MIRT2572172	hsa-miR-4701-5p	CLIP-seq
MIRT2438757	hsa-miR-4708-5p	CLIP-seq
MIRT2431205	hsa-miR-4716-3p	CLIP-seq
MIRT2438759	hsa-miR-4721	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2572173	hsa-miR-4728-3p	CLIP-seq
MIRT2438760	hsa-miR-4728-5p	CLIP-seq
MIRT2572174	hsa-miR-4732-5p	CLIP-seq
MIRT2273309	hsa-miR-4733-3p	CLIP-seq
MIRT2438761	hsa-miR-4739	CLIP-seq
MIRT2438762	hsa-miR-4741	CLIP-seq
MIRT2572175	hsa-miR-4745-3p	CLIP-seq
MIRT2572176	hsa-miR-4747-3p	CLIP-seq
MIRT2431207	hsa-miR-4747-5p	CLIP-seq
MIRT2572177	hsa-miR-4749-3p	CLIP-seq
MIRT2572178	hsa-miR-4753-3p	CLIP-seq
MIRT2438763	hsa-miR-4755-3p	CLIP-seq
MIRT2438764	hsa-miR-4756-5p	CLIP-seq
MIRT2438765	hsa-miR-4763-3p	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT2438766	hsa-miR-4770	CLIP-seq
MIRT2572179	hsa-miR-4783-3p	CLIP-seq
MIRT2438767	hsa-miR-4786-3p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2572180	hsa-miR-4795-3p	CLIP-seq
MIRT2431209	hsa-miR-4795-5p	CLIP-seq
MIRT2438770	hsa-miR-486-3p	CLIP-seq
MIRT2572181	hsa-miR-488	CLIP-seq
MIRT2572182	hsa-miR-499a-5p	CLIP-seq
MIRT2431210	hsa-miR-506	CLIP-seq
MIRT2572183	hsa-miR-515-5p	CLIP-seq
MIRT2572184	hsa-miR-516b	CLIP-seq
MIRT2431211	hsa-miR-519a	CLIP-seq
MIRT2431212	hsa-miR-519b-3p	CLIP-seq
MIRT2431213	hsa-miR-519c-3p	CLIP-seq
MIRT2431214	hsa-miR-519d	CLIP-seq
MIRT2431215	hsa-miR-520d-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT2572185	hsa-miR-526b	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT2572186	hsa-miR-548a-3p	CLIP-seq
MIRT2572187	hsa-miR-548e	CLIP-seq
MIRT2572188	hsa-miR-548f	CLIP-seq
MIRT2572189	hsa-miR-548l	CLIP-seq
MIRT2438772	hsa-miR-562	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT2572190	hsa-miR-564	CLIP-seq
MIRT2572191	hsa-miR-566	CLIP-seq
MIRT2431217	hsa-miR-573	CLIP-seq
MIRT2572192	hsa-miR-580	CLIP-seq
MIRT2572193	hsa-miR-583	CLIP-seq
MIRT2572194	hsa-miR-588	CLIP-seq
MIRT2431218	hsa-miR-595	CLIP-seq
MIRT2572195	hsa-miR-604	CLIP-seq
MIRT2572196	hsa-miR-608	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT2431219	hsa-miR-625	CLIP-seq
MIRT2572197	hsa-miR-628-5p	CLIP-seq
MIRT2572198	hsa-miR-635	CLIP-seq
MIRT2431220	hsa-miR-644	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT2572199	hsa-miR-656	CLIP-seq
MIRT2572200	hsa-miR-661	CLIP-seq
MIRT2438774	hsa-miR-671-5p	CLIP-seq
MIRT2572201	hsa-miR-760	CLIP-seq
MIRT2438775	hsa-miR-762	CLIP-seq
MIRT2043917	hsa-miR-765	CLIP-seq
MIRT2572202	hsa-miR-766	CLIP-seq
MIRT2572203	hsa-miR-873	CLIP-seq
MIRT2572204	hsa-miR-874	CLIP-seq
MIRT2572205	hsa-miR-875-3p	CLIP-seq
MIRT2431221	hsa-miR-885-3p	CLIP-seq
MIRT2431222	hsa-miR-93	CLIP-seq
MIRT2572206	hsa-miR-942	CLIP-seq
MIRT2431185	hsa-miR-106a	CLIP-seq
MIRT2431186	hsa-miR-106b	CLIP-seq
MIRT2572098	hsa-miR-1179	CLIP-seq
MIRT2572099	hsa-miR-1206	CLIP-seq
MIRT2438718	hsa-miR-1207-5p	CLIP-seq
MIRT2572100	hsa-miR-122	CLIP-seq
MIRT2572101	hsa-miR-1227	CLIP-seq
MIRT2572102	hsa-miR-1237	CLIP-seq
MIRT2438719	hsa-miR-1238	CLIP-seq
MIRT2431187	hsa-miR-124	CLIP-seq
MIRT2572103	hsa-miR-1244	CLIP-seq
MIRT2572104	hsa-miR-1248	CLIP-seq
MIRT2572105	hsa-miR-1251	CLIP-seq
MIRT2438720	hsa-miR-1253	CLIP-seq
MIRT2685138	hsa-miR-125a-5p	CLIP-seq
MIRT2685139	hsa-miR-125b	CLIP-seq
MIRT2438721	hsa-miR-1273f	CLIP-seq
MIRT2572106	hsa-miR-1276	CLIP-seq
MIRT2572107	hsa-miR-1299	CLIP-seq
MIRT2438722	hsa-miR-1321	CLIP-seq
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT2438723	hsa-miR-136	CLIP-seq
MIRT2572108	hsa-miR-139-5p	CLIP-seq
MIRT2438724	hsa-miR-143	CLIP-seq
MIRT2572109	hsa-miR-146b-3p	CLIP-seq
MIRT2572110	hsa-miR-1470	CLIP-seq
MIRT2572111	hsa-miR-1538	CLIP-seq
MIRT2438725	hsa-miR-1587	CLIP-seq
MIRT2431188	hsa-miR-17	CLIP-seq
MIRT2438726	hsa-miR-1825	CLIP-seq
MIRT2572112	hsa-miR-190	CLIP-seq
MIRT2572113	hsa-miR-190b	CLIP-seq
MIRT2572114	hsa-miR-1914	CLIP-seq
MIRT2438728	hsa-miR-199a-5p	CLIP-seq
MIRT2438730	hsa-miR-199b-5p	CLIP-seq
MIRT2431189	hsa-miR-20a	CLIP-seq
MIRT2431190	hsa-miR-20b	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT2685140	hsa-miR-2117	CLIP-seq
MIRT2572115	hsa-miR-2909	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT2438731	hsa-miR-299-3p	CLIP-seq
MIRT2273303	hsa-miR-29a	CLIP-seq
MIRT2273304	hsa-miR-29b	CLIP-seq
MIRT2273305	hsa-miR-29c	CLIP-seq
MIRT2572116	hsa-miR-302f	CLIP-seq
MIRT2572117	hsa-miR-3064-3p	CLIP-seq
MIRT2273306	hsa-miR-3065-3p	CLIP-seq
MIRT2572118	hsa-miR-3065-5p	CLIP-seq
MIRT2572119	hsa-miR-3125	CLIP-seq
MIRT2685141	hsa-miR-3126-5p	CLIP-seq
MIRT2572120	hsa-miR-3127-5p	CLIP-seq
MIRT2572121	hsa-miR-3148	CLIP-seq
MIRT2685142	hsa-miR-3150a-5p	CLIP-seq
MIRT2685143	hsa-miR-3150b-5p	CLIP-seq
MIRT2572122	hsa-miR-3156-3p	CLIP-seq
MIRT2572123	hsa-miR-3160-3p	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT2572124	hsa-miR-3168	CLIP-seq
MIRT2572125	hsa-miR-3173-5p	CLIP-seq
MIRT2572126	hsa-miR-3177-3p	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2572127	hsa-miR-3181	CLIP-seq
MIRT2572128	hsa-miR-3182	CLIP-seq
MIRT2438733	hsa-miR-3184	CLIP-seq
MIRT2572129	hsa-miR-3185	CLIP-seq
MIRT2572130	hsa-miR-3187-3p	CLIP-seq
MIRT2572131	hsa-miR-3192	CLIP-seq
MIRT2431193	hsa-miR-3202	CLIP-seq
MIRT2572132	hsa-miR-326	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2572133	hsa-miR-330-5p	CLIP-seq
MIRT2572134	hsa-miR-339-5p	CLIP-seq
MIRT2438734	hsa-miR-34c-3p	CLIP-seq
MIRT2572135	hsa-miR-3611	CLIP-seq
MIRT2431194	hsa-miR-3616-5p	CLIP-seq
MIRT2572136	hsa-miR-3622a-5p	CLIP-seq
MIRT2572137	hsa-miR-3647-3p	CLIP-seq
MIRT2431195	hsa-miR-3647-5p	CLIP-seq
MIRT2572138	hsa-miR-3667-5p	CLIP-seq
MIRT2572139	hsa-miR-3672	CLIP-seq
MIRT2572140	hsa-miR-3675-3p	CLIP-seq
MIRT2572141	hsa-miR-3677-5p	CLIP-seq
MIRT2431196	hsa-miR-3688-5p	CLIP-seq
MIRT2572142	hsa-miR-3689a-3p	CLIP-seq
MIRT2572143	hsa-miR-3689c	CLIP-seq
MIRT2431197	hsa-miR-3714	CLIP-seq
MIRT2572144	hsa-miR-371b-3p	CLIP-seq
MIRT2572145	hsa-miR-376c	CLIP-seq
MIRT2431198	hsa-miR-3910	CLIP-seq
MIRT2572146	hsa-miR-3916	CLIP-seq
MIRT2572147	hsa-miR-3918	CLIP-seq
MIRT2572148	hsa-miR-3920	CLIP-seq
MIRT1153365	hsa-miR-3921	CLIP-seq
MIRT2572149	hsa-miR-3925-3p	CLIP-seq
MIRT1153362	hsa-miR-3944-5p	CLIP-seq
MIRT2572150	hsa-miR-3973	CLIP-seq
MIRT2438735	hsa-miR-423-5p	CLIP-seq
MIRT2431199	hsa-miR-4263	CLIP-seq
MIRT2438736	hsa-miR-4265	CLIP-seq
MIRT2438737	hsa-miR-4270	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2572151	hsa-miR-4278	CLIP-seq
MIRT2685144	hsa-miR-4287	CLIP-seq
MIRT2572152	hsa-miR-4289	CLIP-seq
MIRT2572153	hsa-miR-4290	CLIP-seq
MIRT2431201	hsa-miR-4293	CLIP-seq
MIRT2438738	hsa-miR-4296	CLIP-seq
MIRT2572154	hsa-miR-4301	CLIP-seq
MIRT2572155	hsa-miR-4310	CLIP-seq
MIRT2572156	hsa-miR-4311	CLIP-seq
MIRT2685145	hsa-miR-4319	CLIP-seq
MIRT2438739	hsa-miR-4322	CLIP-seq
MIRT2438740	hsa-miR-4417	CLIP-seq
MIRT2572157	hsa-miR-4422	CLIP-seq
MIRT2572158	hsa-miR-4428	CLIP-seq
MIRT2438741	hsa-miR-4434	CLIP-seq
MIRT2572159	hsa-miR-4436a	CLIP-seq
MIRT2273307	hsa-miR-4436b-3p	CLIP-seq
MIRT2438742	hsa-miR-4441	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT2438743	hsa-miR-4446-3p	CLIP-seq
MIRT2685146	hsa-miR-4469	CLIP-seq
MIRT2438744	hsa-miR-4491	CLIP-seq
MIRT2438745	hsa-miR-4492	CLIP-seq
MIRT2572160	hsa-miR-4493	CLIP-seq
MIRT2438746	hsa-miR-4498	CLIP-seq
MIRT2438747	hsa-miR-4516	CLIP-seq
MIRT2431202	hsa-miR-4519	CLIP-seq
MIRT2572161	hsa-miR-452	CLIP-seq
MIRT2431203	hsa-miR-4521	CLIP-seq
MIRT2572162	hsa-miR-4525	CLIP-seq
MIRT2572163	hsa-miR-4529-5p	CLIP-seq
MIRT2431204	hsa-miR-4530	CLIP-seq
MIRT2438748	hsa-miR-4531	CLIP-seq
MIRT2572164	hsa-miR-4639-3p	CLIP-seq
MIRT2438749	hsa-miR-4639-5p	CLIP-seq
MIRT2572165	hsa-miR-4645-5p	CLIP-seq
MIRT1153367	hsa-miR-4649-3p	CLIP-seq
MIRT2572166	hsa-miR-4651	CLIP-seq
MIRT1153368	hsa-miR-4653-5p	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT2438750	hsa-miR-4656	CLIP-seq
MIRT2438751	hsa-miR-4657	CLIP-seq
MIRT2438752	hsa-miR-4663	CLIP-seq
MIRT2572167	hsa-miR-4673	CLIP-seq
MIRT2438753	hsa-miR-4675	CLIP-seq
MIRT2572168	hsa-miR-4676-3p	CLIP-seq
MIRT2438754	hsa-miR-4677-3p	CLIP-seq
MIRT2438755	hsa-miR-4679	CLIP-seq
MIRT2572169	hsa-miR-4684-5p	CLIP-seq
MIRT2685147	hsa-miR-4685-3p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT2438756	hsa-miR-4688	CLIP-seq
MIRT2273308	hsa-miR-4690-3p	CLIP-seq
MIRT2572170	hsa-miR-4693-5p	CLIP-seq
MIRT2572171	hsa-miR-4700-3p	CLIP-seq
MIRT2572172	hsa-miR-4701-5p	CLIP-seq
MIRT2438757	hsa-miR-4708-5p	CLIP-seq
MIRT2431205	hsa-miR-4716-3p	CLIP-seq
MIRT2438759	hsa-miR-4721	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2572173	hsa-miR-4728-3p	CLIP-seq
MIRT2438760	hsa-miR-4728-5p	CLIP-seq
MIRT2685148	hsa-miR-4732-3p	CLIP-seq
MIRT2572174	hsa-miR-4732-5p	CLIP-seq
MIRT2273309	hsa-miR-4733-3p	CLIP-seq
MIRT2438761	hsa-miR-4739	CLIP-seq
MIRT2438762	hsa-miR-4741	CLIP-seq
MIRT2572175	hsa-miR-4745-3p	CLIP-seq
MIRT2572176	hsa-miR-4747-3p	CLIP-seq
MIRT2431207	hsa-miR-4747-5p	CLIP-seq
MIRT2572177	hsa-miR-4749-3p	CLIP-seq
MIRT2572178	hsa-miR-4753-3p	CLIP-seq
MIRT2438763	hsa-miR-4755-3p	CLIP-seq
MIRT2438764	hsa-miR-4756-5p	CLIP-seq
MIRT2438765	hsa-miR-4763-3p	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT2438766	hsa-miR-4770	CLIP-seq
MIRT2572179	hsa-miR-4783-3p	CLIP-seq
MIRT2438767	hsa-miR-4786-3p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2572180	hsa-miR-4795-3p	CLIP-seq
MIRT2431209	hsa-miR-4795-5p	CLIP-seq
MIRT2438770	hsa-miR-486-3p	CLIP-seq
MIRT2572181	hsa-miR-488	CLIP-seq
MIRT2572182	hsa-miR-499a-5p	CLIP-seq
MIRT2431210	hsa-miR-506	CLIP-seq
MIRT2572183	hsa-miR-515-5p	CLIP-seq
MIRT2572184	hsa-miR-516b	CLIP-seq
MIRT2431211	hsa-miR-519a	CLIP-seq
MIRT2431212	hsa-miR-519b-3p	CLIP-seq
MIRT2431213	hsa-miR-519c-3p	CLIP-seq
MIRT2431214	hsa-miR-519d	CLIP-seq
MIRT2431215	hsa-miR-520d-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT2572185	hsa-miR-526b	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT2685149	hsa-miR-544b	CLIP-seq
MIRT2572186	hsa-miR-548a-3p	CLIP-seq
MIRT2572187	hsa-miR-548e	CLIP-seq
MIRT2572188	hsa-miR-548f	CLIP-seq
MIRT2572189	hsa-miR-548l	CLIP-seq
MIRT2685150	hsa-miR-550b	CLIP-seq
MIRT2438772	hsa-miR-562	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT2572190	hsa-miR-564	CLIP-seq
MIRT2572191	hsa-miR-566	CLIP-seq
MIRT2431217	hsa-miR-573	CLIP-seq
MIRT2685151	hsa-miR-576-5p	CLIP-seq
MIRT2572192	hsa-miR-580	CLIP-seq
MIRT2572193	hsa-miR-583	CLIP-seq
MIRT2572194	hsa-miR-588	CLIP-seq
MIRT2431218	hsa-miR-595	CLIP-seq
MIRT2572195	hsa-miR-604	CLIP-seq
MIRT2572196	hsa-miR-608	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT2431219	hsa-miR-625	CLIP-seq
MIRT2572197	hsa-miR-628-5p	CLIP-seq
MIRT2572198	hsa-miR-635	CLIP-seq
MIRT2431220	hsa-miR-644	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT2572199	hsa-miR-656	CLIP-seq
MIRT2572200	hsa-miR-661	CLIP-seq
MIRT2685152	hsa-miR-670	CLIP-seq
MIRT2438774	hsa-miR-671-5p	CLIP-seq
MIRT2572201	hsa-miR-760	CLIP-seq
MIRT2438775	hsa-miR-762	CLIP-seq
MIRT2043917	hsa-miR-765	CLIP-seq
MIRT2572202	hsa-miR-766	CLIP-seq
MIRT2572203	hsa-miR-873	CLIP-seq
MIRT2572204	hsa-miR-874	CLIP-seq
MIRT2572205	hsa-miR-875-3p	CLIP-seq
MIRT2431221	hsa-miR-885-3p	CLIP-seq
MIRT2431222	hsa-miR-93	CLIP-seq
MIRT2572206	hsa-miR-942	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Activation	17079470;17258390
ATF3	Repression	11792711;15102941
CEBPE	Unknown	19853299
CREB1	Unknown	10506168
ETS2	Unknown	19939245;22108824
ETV4	Unknown	10506168;15317818
ETV5	Unknown	22968857
EZH2	Activation	21629038
HDAC3	Repression	17079677
HIF1A	Activation	17335808
HIF1A	Repression	17332917;18570733
HOXB7	Activation	21183939
HTATIP2	Repression	19349353
JUN	Activation	15777790
KLF4	Activation	22407433
MSC	Activation	18279606
MZF1	Repression	22846578
NFKB1	Activation	17498959;19303700;20352621
NR4A1	Activation	22551568
PAX6	Unknown	17047041
RELA	Activation	17498959;19303700;20352621
RUNX2	Activation	22641097
SP1	Activation	21469139
SP1	Unknown	10506168;15317818;19853299;21045016
SP3	Unknown	15317818
SRF	Activation	12654640
SSX2	Unknown	15781633
STAT3	Activation	17533737;19284568;20069389
STAT3	Repression	17533737
STAT3	Unknown	16540670
TFAP2A	Unknown	10506168;10589685;19853299;19939245;20145123
TFAP2C	Unknown	19853299
TP53	Activation	10029407;11792711;9343394
TP53	Unknown	19853299;19939245
TWIST1	Activation	20646316
TWIST2	Activation	20646316
YBX1	Unknown	10589685

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001553	Process	Luteinization	IEA
GO:0001666	Process	Response to hypoxia	IBA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001955	Process	Blood vessel maturation	IEA
GO:0001957	Process	Intramembranous ossification	IEA
GO:0001968	Function	Fibronectin binding	IEA
GO:0004175	Function	Endopeptidase activity	IDA	23845380
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	2834383
GO:0004252	Function	Serine-type endopeptidase activity	EXP	17428795
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	12032297, 20979576, 21441952, 25613181, 25897080, 28106549, 28514442, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18492766, 24784232
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2834383
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	15863497
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2834383
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007507	Process	Heart development	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0007567	Process	Parturition	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	31879982
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	2834383
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0014012	Process	Peripheral nervous system axon regeneration	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	IMP	31879982
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS	24970228
GO:0030017	Component	Sarcomere	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	23979707
GO:0031012	Component	Extracellular matrix	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035987	Process	Endodermal cell differentiation	IEA
GO:0035987	Process	Endodermal cell differentiation	IEP	23154389
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048246	Process	Macrophage chemotaxis	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0048771	Process	Tissue remodeling	IBA
GO:0048771	Process	Tissue remodeling	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0055093	Process	Response to hyperoxia	IEA
GO:0060325	Process	Face morphogenesis	IEA
GO:0060346	Process	Bone trabecula formation	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:0071492	Process	Cellular response to UV-A	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:1903378	Process	Positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1904645	Process	Response to amyloid-beta	IEA
GO:1904645	Process	Response to amyloid-beta	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	18667463

Other IDs

• MIM: 120360
• HGNC: 7166
• e!Ensembl: ENSG00000087245

Protein

• UniProt ID: P08253
• Protein name: 72 kDa type IV collagenase (EC 3.4.24.24) (72 kDa gelatinase) (Gelatinase A) (Matrix metalloproteinase-2) (MMP-2) (TBE-1) [Cleaved into: PEX]
• Protein function: Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix
• PDB: 1CK7, 1CXW, 1EAK, 1GEN, 1GXD, 1HOV, 1J7M, 1KS0, 1QIB, 1RTG, 3AYU, 7XGJ, 7XJO, 8H78
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01471	PG_binding_1	43 → 97	Putative peptidoglycan binding domain	Domain
  PF00413	Peptidase_M10	118 → 446	Matrixin	Domain
  PF00040	fn2	233 → 274	Fibronectin type II domain	Domain
  PF00040	fn2	291 → 332	Fibronectin type II domain	Domain
  PF00040	fn2	349 → 390	Fibronectin type II domain	Domain
  PF00045	Hemopexin	475 → 518	Hemopexin	Repeat
  PF00045	Hemopexin	520 → 563	Hemopexin	Repeat
  PF00045	Hemopexin	568 → 615	Hemopexin	Repeat
  PF00045	Hemopexin	617 → 660	Hemopexin	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate. {ECO:0000269|PubMed:11751392}.
• Sequence:

  MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
  PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
  KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
  GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
  GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
  SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
  ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
  MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
  IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
  WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
  GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
  

• Sequence length: 660

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
MMP2-related disorder	Likely pathogenic	rs746668134	RCV003393229	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multicentric osteolysis nodulosis arthropathy spectrum	Likely pathogenic; Pathogenic	rs1962181218, rs745677721, rs2142353661, rs201679510, rs2142349089, rs1369454759, rs1168427805, rs794727916, rs121912954, rs1962580119	RCV001730022 RCV001730023 RCV001805735 RCV001806430 RCV001806439 RCV001837584 RCV002250117 RCV001781537 RCV000018644 RCV001170049	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multicentric osteolysis, nodulosis, and arthropathy	Pathogenic; Likely pathogenic	rs2142358933, rs1369454759, rs794727916, rs121912953, rs121912954, rs121912955, rs2142358692, rs1567378779	RCV003147666 RCV005412282 RCV003147377 RCV004576903 RCV003147301 RCV004576904 RCV004576905 RCV004576906	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ovarian serous cystadenocarcinoma	Likely pathogenic	rs746668134	RCV005932799	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AORTIC ANEURYSM, THORACIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC RUPTURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, METABOLIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, CUTANEOUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and oral cavity carcinoma	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC BONE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOLYSIS HEREDITARY MULTICENTRIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TORG-WINCHESTER SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	31032338		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	31032338		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	20205165		★☆☆☆☆ Found in Text Mining only
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	28332074		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	10362121		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	17706812, 23793312, 24938016, 28988362, 29685010		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	17706812		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	21857898		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10650782		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31192912		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10914717, 10995877, 11597382, 12172043, 23205572, 25337226, 26193700, 28365695, 28849259, 7744701, 8986779, 9490275		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14766248, 15609323, 15820246, 18253117, 18473733		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	24325610		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	18253117, 22121096, 28488526		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	27207650		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	27907907		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17240363, 17599056, 20970489, 22503731, 23271813, 23349885, 23591077, 24386189, 27685632, 28606921, 28983601, 30713254, 31140025		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	24344400, 25738313		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	17029196		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	30361787		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	24245968		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	27922483		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	23185624	Stimulate	★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21368903		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	25189759		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18359774, 23536957, 24079541, 26333112, 28944191, 29381911, 30845235, 9761302		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	17448043		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	27914788		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	30973283	Associate	★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	16077930		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	31590404	Associate	★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	21468558		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20561382	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26284520, 26402409, 33986628, 38538217, 39796199	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	28984595		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	18588710, 19709349, 19895658, 29964338		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	18588710, 19096916, 19995435, 25099616, 33067558	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	20576603, 31637161		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12172043		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10027400, 28234925		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	29734379		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	10957667, 11496285, 14681644, 18971037, 23768831, 26071572, 7674473	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	26539497	Inhibit	★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	BEFREE	30169834		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24065540, 29435070		★☆☆☆☆ Found in Text Mining only
Ankylosis of feet small joints	Ankylosis of feet small joints	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	17348445	Inhibit	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	24351915	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27350032, 28284058, 29580808, 30171263, 31597713		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	26528997		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	26528997	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28666838		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28666838		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	16476613, 22010139, 23764410, 24080131, 27659153, 27923483, 28683125, 30530865		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	LHGDN	16476613		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	28198528, 30530865, 7674473	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	10957667, 11496285, 11877705, 14681644, 14743151, 19515587, 22571802, 24980077, 25854712, 28209269	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	15876810	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	22010139, 25120286, 25767191, 28678310, 30530865	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	10415728, 10957667, 11457749, 12208863, 14681644, 16458924, 17957103, 19515587, 20938207, 22094117, 22316675, 22571802, 23144462, 24080131, 24980077, 25376929, 25854712, 27363580, 28288890, 28478022, 28545777, 29687775, 29977360, 30643799, 30935996, 31307051, 31658493, 9588507, 9763536		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Ruptured	Aortic Aneurysm	CTD_human_DG	18178469		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	CTD_human_DG	16159824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	25955575, 28678310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Thoracoabdominal	Aortic Aneurysm	CTD_human_DG	16159824		★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	CTD_human_DG	15545515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Diseases	Aortic disease	Pubtator	23764410	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Diseases	Aortic Diseases	BEFREE	28816402		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Dissection	Aortic dissection	Pubtator	27759651, 28678310, 7674473	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	CTD_human_DG	18178469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Rupture	Aortic Rupture	BEFREE	23144462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Disease	Aortic valve disease	Pubtator	24093773, 32089075	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	24093773		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	34148301	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	15558223, 28420669, 29248646		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	36362368	Stimulate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	28500763		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	1333771, 20064641, 22060290, 27708207, 28220880, 28450836, 28500763, 29579712, 29750899, 30513758, 31733453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	31275742		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	11431697, 15756348, 18985071, 19913533, 22573549, 28326455, 28826781, 28901438, 29218573, 30267195, 9923652		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	18985071, 22824140	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10830778, 16356191, 16507143, 16869002, 17255320, 23632129, 24309559, 26646950, 27498552, 32508836, 33692802, 36398072, 9014820	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34290266	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	11824946, 30689382		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	18985071		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	29149883		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12947131, 23682108, 26074138, 33144422	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16275889, 31428095		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17189319		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10027400, 10506168, 10895974, 16206166, 19775294, 21462187, 22304788, 28234925, 30286327, 9862695		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19775294, 28234925, 32472129	Associate	★☆☆☆☆ Found in Text Mining only
Asymmetric crying face association	Asymmetric crying face association	BEFREE	31353051		★☆☆☆☆ Found in Text Mining only
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	30581847		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	1333771, 20064641, 22060290, 27708207, 28220880, 28450836, 28500763, 29579712, 29750899, 30513758, 31733453		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16510149		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17198804	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20064641, 28193703, 28500763, 32024951, 40076930, 8546199	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	17487426, 19070762, 20138860, 22001292, 27141955, 28043667, 29257298		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	22001292, 27141955, 32201587, 36398072	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30344260	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22951829, 27957827, 28901509, 29725453, 29861101, 30747219, 31189740, 31579948, 31599429		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29349515, 30268789		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22428754		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26319608, 26564800, 27931798		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	27634926, 28413030, 29176317, 29472114, 31501876		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	17382648, 35439345	Stimulate	★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	27339495, 27634926	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	15682828	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	15696117, 16226986		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24402212		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	24402212	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12133547, 20864363, 21784671, 22695075, 22960341, 23819551, 24390660, 24448324, 26166554, 26301605, 28846829, 29237912, 29245935, 31071529, 31240993, 31401412, 31811115		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	17374529, 18802398		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	30548095		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10353746		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	12466243, 14691052, 36135815	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	22122360	Stimulate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	31173221		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	40016774	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	CTD_human_DG	17440987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone Disease	BEFREE	19070762		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone disease	Pubtator	23238945, 33748269	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone disease	Pubtator	33778077	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Marrow Diseases	Bone marrow diseases	Pubtator	35901359	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone Marrow Neoplasms	BEFREE	28611279		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	CTD_human_DG	16475674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone neoplasms	Bone neoplasms	BEFREE	28069877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Resorption	Bone resorption	Pubtator	35363329	Associate	★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	21151391	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	24616914	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	33093584	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	16098049, 23582094	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10027400, 18438431, 21462187, 28569433, 29065106		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10571077, 11250717, 11335709, 12000221, 12574821, 12825860, 1399148, 14604886, 14633660, 14744781, 15538048, 15571322, 15609121, 15742334, 16158251, 16465419, 16776850, 16810131, 16836568, 17683926, 17851253, 18243246, 18266970, 18398872, 18570923, 18777017, 19105967, 19454611, 19617714, 20571065, 20821046, 21161369, 22451655, 22885662, 23292149, 23661021, 23696797, 24051440, 24085799, 24164962, 24211352, 24535905, 24909183, 24960061, 24998547, 24998777, 25124598, 25208219, 25213553, 25501280, 25656607, 25735351, 25828376, 26403314, 26896736, 27177153, 27779707, 28038999, 28069877, 28188787, 28412731, 28739728, 28820254, 29085477, 29113219, 29532526, 29633599, 29805676, 29870887, 30060564, 30074136, 30109192, 30651572, 30689382, 31014197, 31306109, 31409371, 31416219, 31683960, 31820313, 31830149, 31839881, 9062387, 9166284, 9850090, 9932604		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18398872, 18507500		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10571077, 11929863, 14520459, 15054465, 16776850, 16796815, 16929121, 17473389, 17613170, 17725804, 17972522, 19243594, 19454611, 19531263, 19661326, 19796390, 20650008, 21666711, 22524830, 22842186, 22994744, 22994786, 22995648, 23280016, 23696797, 23902685, 24002642, 24164962, 24535905, 24606426, 25029110, 25124598, 25208219, 25268975, 25377085, 25501280, 25735351, 25973015, 26409452, 26501276, 26968831, 26976638, 26996066, 27277077, 27340107, 28529342, 29051606, 30518369, 30848576, 31014197, 31306109, 31322183, 31409371, 31416219, 31683960, 32155880, 33099918, 33301643, 34638797, 34654351, 35650297, 37093687, 37798646, 37890687, 39191502, 8446598, 8663255, 8766524	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20571065, 23534767, 25317801, 32582965	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25656607, 34360714	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	12376362, 14973177		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	25174397		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	23151010	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer of Nasopharynx	Nasopharyngeal Cancer	CTD_human_DG	17607721		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	23637955, 31243109		★☆☆☆☆ Found in Text Mining only
Cancer of Nose	Nose Cancer	CTD_human_DG	16178123		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27277077, 28911071	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	19233958	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14569466, 21750404, 22901190, 24998576, 25755762, 26561467, 27317771, 27363017, 30484490, 30848576, 30965236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	18708724	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10027405, 10628798, 11235994, 11371737, 11812078, 11920583, 11935310, 15250832, 15538048, 15571322, 15742334, 18980971, 19250857, 24245968, 24951956, 27001612, 28927056, 7591310, 7744701, 7981891, 8068180, 8391548, 9198203		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24951956	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	17591960, 22200897	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27406386, 32354918	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16807982, 17473389, 20835647	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	16807982	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	16309203, 24344400	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	17962725	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15133868, 16775432, 19140237, 19239691, 20653060, 21909361, 22546345, 22949882, 23179396, 23468978, 23950866, 24083576, 24317053, 24587407, 24614035, 24675684, 24966965, 24996644, 25236186, 25472720, 26165487, 26204832, 26361419, 26362312, 26404322, 26730736, 26817584, 26847170, 27475525, 28101574, 28358369, 28508927, 28844099, 29962817, 30015898, 30677226, 30685767, 31646557, 31740780, 33378016, 33902004, 34854209, 35260047, 35293286, 35650297, 35840921, 38025683	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27465549, 36116407, 40650282	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	9736043	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	11812078		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20835647	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12133547, 19219652, 20864363, 21784671, 22695075, 22960341, 23819551, 24390660, 24448324, 25647262, 26166554, 26301605, 28846829, 29237912, 29245935, 29588320, 30548095, 31071529, 31240993, 31401412, 31811115, 7591268		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27075652		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11935310, 12124327, 12438229, 12873995, 14981939, 15731163, 16985063, 17335808, 17599056, 18559520, 19068083, 19507256, 19814619, 20027628, 20360147, 20845079, 21688086, 22082235, 22158108, 22455335, 22718017, 22938472, 23313298, 23465389, 24415566, 25004182, 25150396, 25270791, 25486572, 25636510, 26148594, 26151179, 26198673, 27260467, 27545207, 28352360, 28824722, 29024500, 29113325, 29312740, 29541242, 29565268, 29850505, 30147314, 30214563, 30256540, 30305224, 30378152, 30388099, 30431227, 30477473, 30851455, 31131637, 31670285		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16124061, 17314270, 17962725, 19324884, 29949791, 30485902, 32718331	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19893036, 25137018, 26850699, 27429508, 28284058, 28475017	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10454537, 12410931, 12445230, 12657102, 21808237, 23006512, 23281640, 24802708, 24986570, 25031735, 26304749, 27166254, 27806310, 29103203, 31217736, 31599407, 31789394, 32319593, 32413671, 33059651, 36766694	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10376963, 12218298, 12669237, 14990972, 20874839, 25400809, 26050228, 26515234, 28604655, 31053522, 7961122	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	9685743	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	18251742, 27406386, 8391548		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	24344400, 25738313		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11748988, 15781636, 16806441, 18340378, 19324884, 22579115, 22595649, 22832979, 23915071, 24245968, 25347277, 26099492, 27995372, 28571726, 29721047, 30182276, 30952722, 31282404		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	21808237		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	24398929		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	27001612		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	18985071		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	34859099	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	10937947, 27890770, 36866790	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	21890325	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	17849172, 27032379		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17289174, 18940384		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19070762, 21266537, 22323339, 23242659, 25416694, 26025700, 26637202, 28164126, 28715234, 28988362, 29369845, 29891747, 30557881, 31669421, 31830479		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27412873, 28390988, 32455133, 36614132, 36866790	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	21471148		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	18166633		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	28500763		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28500763	Stimulate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11762938, 24067484	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22259225, 31081067, 31755246, 33832130	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	26539028, 31081067		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32180680	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	15608660	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	21569377	Associate	★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	31738197		★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	12753080, 20576603, 21707819	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	19164781		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	26551785	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	26617904, 28193703, 30278505, 30657570, 33778069, 34159826	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	29420160, 30309728, 30657570, 30723388		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy	Cerebral palsy	BEFREE	30680957		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	28193703	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11720009, 18560213, 20222942, 28193703, 28481164, 29524637, 30099039, 30233326, 30278505		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28642174		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10780674, 18177928, 22846578, 24804816, 26191191, 26526578, 26561467, 28487974, 28902345, 30158710, 30820752, 31830929		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	LHGDN	14614057		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	24804816		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10366463, 10780674, 15665394, 17167534, 18177928, 21422052, 22527983, 22846578, 24804816, 26191191, 26526578, 26561467, 28487974, 28902345, 30158710, 30820752, 31830929		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	28543409		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	35372112	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	23856618, 28118356, 31057540, 35372112	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19748669		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	29349515		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21368903		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	19629755, 23480758, 28482619, 30444036, 35792239, 38123132	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19721413, 23494562		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	22621753		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	22621753		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	9736043	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	28233754, 28477356, 31113607		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	Pubtator	22714856, 33778077	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	31086579		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	10473866, 15736455, 22968857, 23320110, 24047437, 24085323	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	17640487, 22968857, 23320110, 25145279, 28672103, 29573200		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15294019, 19426551, 22858163, 8831562		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	17475706	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	29267209	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	14580155, 27551966		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22302011, 27461219, 29891747		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	16891619, 28397744, 29462885, 29915813, 29932881, 30347133		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23708561, 28978315		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17099140, 20075389, 20078883, 22094117, 26439471, 27412345, 28648837		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	10776921, 25826490	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	16018746, 18155181, 28492359		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26063981	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28400178		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	22391064, 23257253, 23987197		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	28662285		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30336268		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	31053527		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	24589636, 27876897	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35363329	Associate	★☆☆☆☆ Found in Text Mining only
Clubfoot	Clubfoot	Pubtator	35292718	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	LHGDN	18611410		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	25004843		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28887194		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22417974		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10940281	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12651627, 21477272	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12184536, 12235002, 15588763, 15623631, 19445018, 19665518, 21531813, 21866366, 22684547, 22898815, 23645734, 24222121, 24289619, 24325610, 24998576, 25201136, 25216407, 25326065, 25814779, 28970726, 29749478, 30306455, 30349300, 30987352		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10402168, 25110240, 32813775	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12184536		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15918191	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17876296, 18172354		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	1323219, 14520690, 15485653, 15588763, 16739355, 17311017, 17348445, 17546628, 18506186, 19507256, 21378341, 21531813, 21968416, 22030865, 22472880, 23184003, 23202950, 24289619, 24998576, 26596835, 26714817, 27145365, 27222481, 27633042, 27806345, 27907907, 27922483, 28237576, 28259937, 28269751, 28335083, 28454367, 28624785, 29260353, 29338680, 29687772, 29917190, 30228782, 30472235, 30538563, 30556860, 30581847, 30807603		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	18507500, 21278247		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	27207650		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10901373, 11401321, 11786732, 11857296, 15918187, 15991286, 16101153, 16619535, 16916471, 17348445, 17649785, 17876296, 18506186, 18925697, 19445018, 19930715, 21229878, 21968416, 22472880, 22898815, 23801889, 24289619, 24314144, 24395652, 24720439, 24737953, 24998576, 25750173, 26269673, 26617761, 26714817, 26942563, 27034162, 27098148, 27207650, 28269751, 28416735, 28624785, 28653875, 28970726, 29917190, 30228782, 30365116, 30556860, 30807603, 30987352, 31173256, 32167616, 32277631, 32286443, 32751332, 32945508, 33090398, 33846436, 34512817, 34830271, 34885656, 35029289, 35419458, 35468741, 35645356, 35647190, 36882818, 37516013, 37575276, 37751586, 37933160, 38165763, 40229707, 7992833, 9836483	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12097300, 12184536, 15860507, 20191032, 22898815, 8913260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14520690, 14666611, 15485653, 17546628, 18214299, 18425389, 18506186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	18507500, 21278247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	27207650		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	16884384		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	24771337, 31275742		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	15696117, 16226986		★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	27173256		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	20625418, 29334797	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	27173256		★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital omphalocele	Congenital omphalocele	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	14580155, 19295411, 19332048, 27551966, 28399617, 29663512, 29915813, 30798618, 31297506		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15519565, 15882758, 16596214, 17541305, 18189328, 19448672, 21045016, 25571919, 25588050, 27166254, 27732931, 27806310, 28277191, 28487942, 29312615, 29396852, 29901172, 30224058, 31217736		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	19936308	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	28332021		★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	19900203, 31022731	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	31002472		★☆☆☆☆ Found in Text Mining only
Corneal Opacity	Corneal opacity	Pubtator	31268248	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	LHGDN	12967855		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	12103254		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14996438, 18035073, 21142815, 25955575, 26166126, 28043667, 28595560, 30443948		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12103254	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	14996438, 18035073, 21142815, 21576412, 22226810, 22664146, 25124382, 25955575, 26166126, 27781958, 28043667, 28595560, 30443948		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	14996438		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31886261	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31929842, 36362368	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Dissection Spontaneous	Spontaneous coronary artery dissection	Pubtator	33866193	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	22388798	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12454321, 14996438, 18035073, 21142815, 22226810, 25955575, 26166126, 28043667, 28595560, 30443948		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18035073		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	20129576	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary Restenosis	BEFREE	21206012		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12651627, 17243139, 21438097		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12651627, 21535409	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22098497	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	31295049		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16047212		★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	BEFREE	19010778, 25376929, 9666818		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	16213873, 28821422		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10628798, 21743026		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19604728	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29264695, 30651780, 31633295		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14730609, 16507143, 17498959, 18802702, 23780780, 24289792, 28981555		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28984595, 30412498		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	22515887, 32398053, 37031884	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26856768, 27098106, 27434116		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	LHGDN	16919028		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26133107, 29157812		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	16097959		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11457723, 12164930, 12801609, 16778129, 18075496, 19345729, 19360430, 24903024, 26025700, 26843101, 28715234, 30253743, 9447953		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11457723, 12164930, 12801609, 16778129, 18075496, 19345729, 19360430, 22171077, 24903024, 26025700, 26843101, 27297874, 28178341, 28715234, 29366755, 29615288, 30244088, 30253743, 30947565, 31295411, 31461499, 9447953		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11457723, 16778129, 20348234, 24172699, 27104752	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19074676	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19539633, 32455133, 33338031, 34054346	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18182154	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35281591	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12372938, 28550760, 29700214, 30296017, 30396876, 30915367		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12454321, 18184904, 24903024, 26025700, 27461219, 28521406, 29957017, 30253743, 30964398, 9447953		★☆☆☆☆ Found in Text Mining only
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	26221614, 31184591	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	26492282, 26843101		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	26843101	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29123184, 33435900, 36726458, 36896170, 38013385	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	12372938, 16728425, 24068281, 28178341, 29636780, 29883760, 9447953		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16728425		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	20213226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	19345729, 28662829, 30215334, 30662833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissection of aorta	Aortic dissection	BEFREE	16609908, 26762140, 28239811, 28678310, 30626766		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	21438097		★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double Outlet Right Ventricle	HPO_DG			★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	17962725	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	17473389		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	22342364, 22987740	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	17440987		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysautonomia Familial	Dysautonomia	Pubtator	22252855	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	31677173		★☆☆☆☆ Found in Text Mining only
Dyssegmental dysplasia	Dyssegmental Dysplasia	BEFREE	12568417		★☆☆☆☆ Found in Text Mining only
Dyssegmental dysplasia	Dyssegmental dysplasia	Pubtator	12568417	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	28143958		★☆☆☆☆ Found in Text Mining only
Ectopia Lentis	Ectopia lentis	Pubtator	31180551	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	16077930		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	18723334, 19605697	Associate	★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	11400152		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10469168, 11920503, 20113256, 23205572, 24287565, 24344400, 25308734, 26815505, 28721066, 30022838, 30024495, 30070342, 30832559, 30988628, 31100338		★☆☆☆☆ Found in Text Mining only
Endometrial Diseases	Endometrial Diseases	BEFREE	28721066		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	19249761	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	19426551		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	11920503, 17624083, 17638886		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11920503, 12372458, 12631221, 16407419, 17009991, 18644593, 22640183, 22964525, 23099861, 23786715, 24344400, 25308734, 26815505, 27898420, 28871006, 30070342, 33072202	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	12893436		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18607832	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	11895472, 29300932		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12034345, 12372458, 12587534, 18177649, 18288718, 18295959, 18543216		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	12372458, 12587534, 18177649, 19345347, 19426551, 20056200, 20100617, 22985025, 23364396, 23855590, 23979130, 24661733, 27695098, 28030938, 28676525, 29266528, 29924731, 30024495, 30186424, 30777471, 30940310, 30981279, 31636643		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	12372458, 33072202	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18177649, 19055724, 20100617, 20378112, 23557756, 23855590, 23979130, 24661733, 30981279, 34913072	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25539192		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	25539192, 31636346	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	12880418	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29632167		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	11748988, 16806441, 19324884, 30952722		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	22288519, 24951956, 8561867		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	22428754		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	30449890		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	30449890	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal and Gastric Varices	Esophageal and gastric varices	Pubtator	30392570	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal atresia	Pubtator	22123559	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12733139, 15492291, 19212830, 21879284, 22340517, 22859270, 25724186, 27697099, 28454222, 30940778		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12733139, 15931594, 23264224, 24168165, 25724186, 27697099	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15492291, 19212830, 22859270, 25724186, 27697099, 30940778		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24022664	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	14569466, 15372476, 20920372, 22522455, 23667687, 25724186, 25966235, 27125974, 28488526, 29693138, 30280774, 33149553, 33909822, 37796690	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	14569466	Inhibit	★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	20808730		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	23098370	Associate	★☆☆☆☆ Found in Text Mining only
Factor XIII Deficiency	Factor xiii deficiency	Pubtator	31469059	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	15863640	Stimulate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	28098879		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	28098879		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30821873, 30986937		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	31839881, 8446598		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15004438, 17943549		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	25398968, 30015921		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10667602, 11112341, 11340084, 1662501, 17498959, 19910495, 20132738, 25545756, 25912851, 26176658, 28659595, 29518973, 30744075, 8305481		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15479690, 15482348, 15696117, 16226986, 20563750, 23734997, 25076423, 27260943, 28304404, 29214887, 29970958, 30019784, 30336268, 30367152, 9075665		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	15763341, 26396155		★☆☆☆☆ Found in Text Mining only
Flexion contracture - wrist	Flexion Contracture Of Wrist	HPO_DG			★☆☆☆☆ Found in Text Mining only
Focal Emphysema	Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	17205957		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	16430475		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	27463962, 31092435		★☆☆☆☆ Found in Text Mining only
Fraser Syndrome	Fraser syndrome	Pubtator	19435948	Associate	★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	27594586		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	27594586	Associate	★☆☆☆☆ Found in Text Mining only
FUNDUS DYSTROPHY, PSEUDOINFLAMMATORY, OF SORSBY	FUNDUS DYSTROPHY, PSEUDOINFLAMMATORY, OF SORSBY	BEFREE	14597066		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22621753, 24438533, 24863943, 28129656		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	12439941, 24863943, 29034777, 34913073	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	21483125		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	20333791		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	20333791, 24669030	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	37958643	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	7591960		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	22072145	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	9836483	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	15519565, 19298600, 22489693		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24935368, 30221743	Associate	★☆☆☆☆ Found in Text Mining only
Generalized osteoporosis	Osteoporosis	BEFREE	17563705		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	28944191		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	35119039	Stimulate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	12873995, 17502363, 21148629, 29970365		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	15998676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant cell arteritis	Pubtator	17502363, 34204585	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	16598420		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	25764026	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	29963137, 8030443		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	14704547		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	19572226, 39769228	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	18323704, 36254076	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	18323704	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	20808730, 22605928, 26539028	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	15534474, 15985430, 20808730		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20808730, 23725205, 26539028		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10027400, 10389763, 10895974, 11853893, 12907597, 12918061, 14631378, 16084059, 16622457, 18339876, 18438431, 19176371, 20680398, 20730561, 21289335, 21483125, 22304788, 22673390, 22711523, 23232806, 23970099, 25213694, 25256634, 25948484, 26717894, 27678152, 28112361, 28234925, 28287096, 28569433, 28600709, 28780604, 29683097, 29848673, 29977365, 30431227, 30834619, 30885764, 30926752, 30949900, 31028823, 31106423, 9708803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	12918061, 14631378, 16084059, 19176371, 20448453, 20730561, 24552705, 26299938, 26474590, 27363017, 28470949, 28600709, 29538296, 30353649, 30867563, 32074974, 33919029, 34234410, 34345995, 35682709, 35814563, 37014551, 37591452	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	16598420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	LHGDN	19176371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	28234925	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	10027400, 10389763, 11853893, 12907597, 14631378, 16084059, 16622457, 17047041, 17404569, 18339876, 18438431, 19176371, 20680398, 20730561, 21289335, 21483125, 22673390, 22711523, 22766851, 23232806, 23381805, 23970099, 25213694, 25256634, 25948484, 26717894, 27678152, 28112361, 28234925, 28287096, 28408249, 28454354, 28600709, 28780604, 29338907, 29545552, 29683097, 29848673, 29977365, 30219696, 30431227, 30834619, 30885764, 30926752, 30949900, 31028823, 31106423		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	16598420		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10206300, 10389763, 10506168, 10895974, 10980594, 10996658, 11409528, 12220955, 12907597, 16773187, 18438431, 18652821, 18802741, 19033423, 19617536, 19724922, 20383200, 21205070, 21289335, 21331614, 21483125, 21573233, 21698233, 21874244, 22349830, 23254288, 23660683, 23827186, 24968089, 25060559, 26729052, 26938295, 27154818, 28265824, 28443475, 28817313, 29035824, 29203120, 29278874, 29686590, 30368528, 30670934, 30675244, 31186720, 31545229, 31593589, 31773703, 31831299, 9410885		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10206300, 10638966, 10996658, 11302334, 12454020, 17490812, 19033423, 19724922, 20448453, 20511184, 20646316, 21205070, 21483125, 21698233, 22362300, 23166329, 24587321, 24879377, 25596741, 26328748, 26473829, 26617746, 26722455, 27334625, 27589728, 27613828, 28161812, 28506595, 28780604, 28849217, 30178845, 30223389, 30373180, 31545229, 31593589, 31773703, 32851798, 33694259, 36181980, 37587889, 9410885, 9721888	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12764090, 15743799, 17437609		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25872784	Stimulate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	22288519	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	29103203	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11014984, 28584626		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	17205957		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	22845765	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	20529817, 31726998	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28645189, 31545275, 9658163		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	15547092		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	15547092	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29521049		★☆☆☆☆ Found in Text Mining only
Growth retardation, Alopecia, Pseudoanodontia and Optic atrophy	Growth Retardation, Alopecia, Pseudoanodontia And Optic Atrophy	BEFREE	25572963		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	28916318		★☆☆☆☆ Found in Text Mining only
Hajdu-Cheney Syndrome	Hajdu-Cheney Syndrome	BEFREE	11431697, 18985071, 23900523, 31268248		★☆☆☆☆ Found in Text Mining only
Hajdu-Cheney Syndrome	Hajdu-Cheney Syndrome	LHGDN	15691365		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10840163, 16275157, 20360147, 21380786, 23637955, 24705283, 26820361		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24705283, 25313763	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	18985071, 19523958	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22323339, 28987763, 29050751		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27551966, 28399617, 29663512, 29915813, 30798618, 31297506		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	27551966	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	21350055	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	27908427		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	28601470		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24627195, 27039800, 28501516, 30747385		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	26551785	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	10424282, 9659170		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	23287320	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	9659170	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23151010	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	15215164	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	18037806, 20576603, 21707819, 26551785	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	12753080	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	21707819	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatic methionine adenosyltransferase deficiency	Hepatic Methionine Adenosyltransferase Deficiency	BEFREE	31307051		★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	21330458	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35868407	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22951829	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15479690	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	8446598	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Factor XIII Deficiency	Hereditary Factor XIII Deficiency	BEFREE	31469059		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	10697802, 12710748		★☆☆☆☆ Found in Text Mining only
Hip Contracture	Hip Contracture	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10477738		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	12431239		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	35868407	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	12614934		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29459817		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	16884384, 22425662		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	16884384	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole, Partial	Hydatidiform Mole	BEFREE	16884384		★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	16884384		★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	35040478	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	15662225		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28178341, 28770228, 28989027, 29524637, 30793207		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	16896935, 28636071, 31377002		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	24785109, 27659153		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	15662225		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	25115216, 26564800	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19698156, 35263399, 35439345	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	22388798, 27412873, 28390988, 30684802, 37181702	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	33760199	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension, Renovascular	Hypertension	BEFREE	29425960, 31830479		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17188706, 18332634		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	18836702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21307882, 24705390, 25416694, 26637202, 26731549, 28034583, 28374979, 29334797, 29569955, 30336141, 30339939, 30399409, 30684802, 9658163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	15056834		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21890325, 31639652		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31639652		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	28390988, 35263399	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17099219, 17273772, 21640519, 23289374, 23307318, 24106289, 26286316, 28426715, 29218693, 31268159, 31618079, 32858793, 36285283	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19523958, 23965235, 32096196	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23314174, 29414807, 30646538, 33067558, 35729773	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	10971173		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29913136		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16933466		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18723334, 36221131	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31726998		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35901359	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24385215		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28887194		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10861266	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	12651627		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23809662, 31652976		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31652976, 36726458	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	26403314		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	26133107, 29157812		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	38034020	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	17680282, 25640554, 30915367, 32626912, 34395625	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23453657, 25839387, 30084796		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	17680282, 23852912, 40016774	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	29700214, 30296017, 30915367		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	16961137, 21228795, 29334797, 31338876		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	23516489, 23768831, 29334797	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Meningioma	Intracranial Meningioma	BEFREE	25259564		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28915621		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	28233754	Stimulate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	23280016, 24909183, 28521406		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31652976		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26617904, 26823694, 28193703, 29906531, 30278505		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	37338050	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	31781639		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	17188706		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	15105792, 36051483	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	7507419, 8156782		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	16313894, 16891619		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17205957, 17563705		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17898039	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	16891619, 24980077, 29915813		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	21671855, 27020372, 28331061, 30371703, 30385051, 31633603		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22302011, 27461219, 28460073, 29891747		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	17541305		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17541305, 33059651, 35399832, 36674555	Associate	★☆☆☆☆ Found in Text Mining only
Kienbock Disease	Kienbock Disease	CTD_human_DG	19070762		★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	19903768, 28766880		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	24357157, 27075652, 31882488, 32719260, 9555115	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	15746850, 16265652, 28466560, 30714134, 31384171		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	9555115	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28390988		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	23814095, 28929861, 29747655, 30015921, 34256950, 37487574, 40280719	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	LHGDN	15051038		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	16202218	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20008541	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	35480232	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10650782, 22865631, 23179400, 30842148		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12771921, 21705840, 29883990	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	30225259	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10233411, 23179400, 26884713, 27039800, 35935313	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10353746, 10650782, 18081721, 22924417, 26884713, 27039800		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18081721		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	25189759		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22072145		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	18597705		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	18597705		★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	23852912		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28627704, 30648329		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24658023, 26036622, 27853937, 28595731, 29962088, 30023811, 30191992, 30504396, 30639311, 31458539		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma	Liposarcoma	Pubtator	11249053, 21598240, 31387924	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	24285420		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10089944, 10914717, 11431737, 12011989, 12745093, 15133868, 15455231, 16763805, 17187364, 18177474, 18636172, 20151228, 20969862, 21104440, 21132267, 21512310, 21712445, 21842128, 22395332, 22546345, 23029478, 23232575, 24018669, 24059678, 24587407, 24736611, 24792036, 25251472, 25671640, 26730736, 27109804, 27230279, 27475525, 27693494, 28276313, 28337887, 28670372, 28810927, 28959024, 29375378, 29894725, 30177376, 30349190, 30677226, 30685767, 30723742, 31157304, 31396320, 31777601, 8690399, 9075667, 9736043		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17564313, 18177474		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	20084675		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	15479690, 15591520, 21330458, 35650297	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	15763341, 26396155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30336268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	10830778	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	23274713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	15479690, 19432809, 8129038	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	26097608	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12011989, 24059678, 9075667		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	18337444		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	24068394	Associate	★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	17680282, 23852912		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24415566, 28662821, 29113325		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	15651999	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11452866, 11728453, 11935310, 12087091, 18288638, 19165865, 19643940, 19855090, 19903768, 21151391, 21483125, 21688086, 22158108, 22455335, 23271813, 23563849, 24321786, 26198673, 26230665, 26498639, 29024500, 29565268, 29850505, 30060029, 30078010, 30256540, 30477473, 31034948, 31131637, 31298335, 31670285, 32198390, 33115469, 35163164, 35178453, 35650297, 35898682, 36171576, 36553576, 37445754	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12393872, 14981939, 15375490, 17208328, 17570740, 18288638, 18366007		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	18559520, 20027628, 23271813, 30147314, 30157785		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22593690	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26198673	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25416694		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33093251	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25416694		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22323339, 25416694		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	CTD_human_DG	22479529		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	28584626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	30973283	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25416694		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	15111304, 18285421, 19395678		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12460468, 17009991, 20563765, 22820140, 25317801, 33115469	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15022276	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15918187, 15929171, 16718824, 16796815, 17094486, 19140237, 19445018, 20586027, 23280016, 23685894, 24357157, 28621235, 29917190	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	24700287		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25702581	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	22020421, 24627195		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	22020421, 24627195		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	11466410		★☆☆☆☆ Found in Text Mining only
Macular degeneration	Macular Degeneration	BEFREE	29381911		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	29381911, 29582818	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	CTD_human_DG	16475674		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10206300, 10895974, 18652821, 21331614, 21698233, 30214229		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10840163, 16275157, 20360147, 21380786, 23637955, 24705283, 26820361		★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	BEFREE	29260433		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	12771921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21462187		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10571077, 11250717, 12000221, 12574821, 12825860, 1399148, 14604886, 14633660, 14744781, 15538048, 15571322, 15609121, 16158251, 16465419, 16776850, 16810131, 16836568, 17683926, 17851253, 18243246, 18398872, 19105967, 19454611, 20571065, 20821046, 21161369, 22451655, 22885662, 23292149, 23661021, 23696797, 24051440, 24085799, 24164962, 24211352, 24535905, 24909183, 24960061, 24962947, 24998547, 24998576, 24998777, 25124598, 25208219, 25213553, 25469981, 25501280, 25656607, 25735351, 25828376, 26403314, 26896736, 27177153, 27779707, 28038999, 28069877, 28412731, 28739728, 28820254, 29085477, 29113219, 29532526, 29633599, 29805676, 29870887, 30060564, 30074136, 30109192, 30651572, 30689382, 31014197, 31306109, 31409371, 31416219, 31683960, 31820313, 31830149, 31839881, 8646366, 9154157, 9850090		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18398872, 18507500		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20113256, 23205572, 25308734, 28721066, 30022838, 30024495, 30070342, 30832559, 30988628, 31100338		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15492291, 19212830, 20360147, 22859270, 25724186, 27697099, 30940778		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22621753, 24438533, 24863943, 25405519, 28129656		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	21722821, 23644699		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23281640, 25273173, 9255309		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	27207650		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20885449, 29228655, 30132565, 9075667		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11935310, 12438229, 12873995, 14981939, 15731163, 16985063, 17335808, 17599056, 18559520, 19068083, 19507256, 19814619, 20027628, 20360147, 20845079, 21688086, 22082235, 22158108, 22455335, 22718017, 22938472, 23313298, 23465389, 24415566, 25004182, 25150396, 25486572, 25636510, 26148594, 26151179, 26198673, 27260467, 27545207, 28352360, 28824722, 29024500, 29113325, 29312740, 29541242, 29565268, 29850505, 30147314, 30214563, 30256540, 30378152, 30388099, 30431227, 30477473, 30851455, 31131637, 31670285		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23637955, 24658023, 26036622, 27853937, 28595731, 29962088, 30023811, 30191992, 30504396, 30639311, 31458539		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	23637955, 31243109		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15781636, 18340378, 19324884, 22579115, 22595649, 22832979, 23915071, 24245968, 25347277, 26099492, 28571726, 29721047, 30182276, 31282404		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12167581, 15257104, 15349101, 15492268, 17140727, 19056927, 19266599, 20482858, 23712777, 23745588, 24511528, 25017645, 25863127, 25883224, 26866436, 27459514, 28284058, 29355139, 30352219, 30466735, 30719232, 30720116, 30803757, 30958531, 31060006, 31404611, 31441002, 7635566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	30603057		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12361907, 12697668, 14598888, 15356679, 16407830, 16956360, 18398039, 18612129, 19117773, 19303106, 19578386, 19633975, 19638505, 19819277, 20160036, 20207476, 21219645, 21248144, 21649463, 22200661, 22374248, 22555040, 22573553, 23424616, 24453046, 24475196, 25154741, 25310386, 25577646, 25917126, 26319608, 26564800, 27329245, 27541146, 27931798, 28122633, 28445160, 29107109, 29175302, 29300772, 29358129, 29440967, 30294801, 30520325, 30917169, 9950685		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	27569079		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	18251742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12673424, 15929171, 17236757, 17486447, 18330957, 20333791, 20360147, 20514448, 21612407, 22460086, 23736018, 23901223, 24072772, 24130168, 26291058, 27291049, 29262634, 29783070, 31218131, 31841039		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21493587, 22042554, 24106286, 26312762, 26695142, 28709407		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20864363, 21784671, 22695075, 22960341, 23819551, 24390660, 24448324, 25647262, 26166554, 26301605, 28846829, 29237912, 29245935, 29588320, 30548095, 31071529, 31240993, 31401412, 31811115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	30548095		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10353746, 10555745, 10579795, 10598205, 10755382, 10914717, 11327697, 11935310, 12000221, 12064464, 12184536, 12566302, 12771921, 12810630, 12873995, 1333771, 14500381, 14612977, 15028476, 15133868, 15280448, 15356679, 15492291, 15581913, 15623631, 15731163, 15870919, 16707450, 16985063, 17546628, 18177474, 18210196, 18454694, 18598724, 19301652, 19363519, 19445018, 19449375, 19454611, 20031158, 20044778, 20118983, 20190804, 20333791, 20360147, 20442303, 20650348, 20864363, 21219645, 21422052, 21462187, 21537843, 21573233, 21637915, 21792195, 21824723, 21880183, 22088328, 22175896, 22349830, 22374248, 22386573, 22410782, 22417974, 22522455, 22781396, 22962598, 22968857, 22998183, 23042506, 23079671, 23128378, 23134156, 23644699, 23675494, 23807739, 23855590, 23902685, 24210072, 24385215, 24627195, 24782132, 24804816, 24909183, 25010662, 25124598, 25213694, 25236491, 25412957, 25476160, 25725450, 25735378, 25812648, 25826088, 26225806, 26319608, 26546460, 26637202, 26691328, 27039800, 27145365, 27436149, 27541146, 27569079, 27693460, 27853937, 27922483, 28044166, 28365695, 28365980, 28408249, 28454222, 28498494, 28601470, 28611279, 28633655, 28824722, 28956695, 29065106, 29088927, 29112150, 29164666, 29225138, 29260353, 29318240, 29338907, 29355139, 29356020, 29588320, 29614094, 29620225, 29949791, 29986882, 30023811, 30024495, 30248101, 30342958, 30359388, 30497018, 30504396, 30628094, 30688465, 30820752, 31037134, 31091081, 31301415, 31311559, 31353078, 31370697, 31375695, 31669421, 31670285, 31686863, 31711773, 31820313, 31827393, 31830149, 7591960, 7744701, 7981891, 9514536, 9862695		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	16699496		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10780674, 18177928, 22846578, 24804816, 26191191, 26526578, 26561467, 28487974, 28902345, 30158710, 30820752, 31830929		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12184536, 12235002, 15588763, 15623631, 19445018, 19665518, 21531813, 21866366, 22684547, 22898815, 23645734, 24222121, 24289619, 24325610, 24998576, 25201136, 25216407, 25326065, 25814779, 28970726, 29749478, 30306455, 30349300, 30987352		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	27207650		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18398872, 18507500		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	19360105		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11929863, 12602913, 14744781, 15569994, 15609121, 15754118, 16158251, 16168111, 16615109, 17175151, 17203213, 17613170, 17725804, 18160708, 18644862		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18398872, 18507500		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18644862, 23280016, 31416219		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18398872, 18507500		★☆☆☆☆ Found in Text Mining only
Mandibular Diseases	Mandibular Diseases	CTD_human_DG	19070762		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	24402212		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	16820601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome	Marfan Syndrome	CTD_human_DG	18178469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome	Marfan syndrome	Pubtator	32961817, 37445606	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome, Type I	Marfan Syndrome	CTD_human_DG	18178469		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	28912068, 31834839		★☆☆☆☆ Found in Text Mining only
Maxillary Diseases	Maxillary Diseases	CTD_human_DG	19070762		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21368903, 9708803		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	37821528	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10409657, 10844565, 10998134, 12404291, 15009703, 16397238, 16675961, 16829852, 16946713, 18826517, 20098411, 21397857, 24548268, 24766647, 24920276, 25184134, 25313763, 25784655, 25954957, 27007357, 27436149, 27926479, 28627651, 28699701, 29722524, 30042328, 30072397, 30205394, 31019293, 32051510, 32134466, 32360863, 32510182, 33402468, 33504439, 35011253	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10415749, 10555745, 10667602, 10763911, 10844565, 11764382, 12789289, 15009718, 15998788, 16047212, 16306050, 16397238, 16631740, 17498549, 18251742, 18292932, 18974154, 19047140, 19058223, 20969766, 22992115, 23067222, 23695439, 24090196, 24178756, 24246091, 25313763, 25505176, 26667022, 27458061, 28440509, 28454306, 29047110, 29113270, 29164766, 30021673, 30762711, 30928981, 31019293, 31020875, 7534227, 8056455, 9500469, 9632718		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11918086, 15009703, 15604254, 15998788, 16379022, 16718267, 17845054, 18031543, 18045645, 18187184		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19305641	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26293674	Inhibit	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	14612977, 19885562, 23238945, 25259564, 27779709, 30021149		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	16722933		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	16894529, 23238945	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26856768, 27098106, 27434116		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11027427, 33028834	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	16447244, 21983934, 29721201		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292, 12771921, 16206294, 21802412, 23563849, 29138529, 30316293	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	CTD_human_DG	17440987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	38034020	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23242659, 24192303, 27219887, 31279616		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	18292932, 19305641		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24589892		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	27157622		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	27748762		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	23043936		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	23043936	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	23043936		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	23043936	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	39273357	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	18835790, 28750369		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	26768647		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	10216103		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	15651999	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20008541	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	24658023, 25117810, 26036622, 27853937, 30355929, 31387166, 32224968, 32934875, 34204617, 36172677	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	25280484		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	25280484	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	25280484		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	18091353, 25174397		★☆☆☆☆ Found in Text Mining only
Multicentric osteolysis-nodulosis-arthropathy spectrum	Multicentric Osteolysis, Nodulosis And Arthropathy	Orphanet			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10216103, 10553104, 23387827, 28611279		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10216103, 17593251, 23387827, 26268417, 29020881, 9269785	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11097203, 35604822	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	18472160		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12020967, 18835646, 21207142, 24616914, 24751386, 26298319, 26768647, 27174941, 27409770, 29158162, 8957442		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24616914, 24751386, 26768647, 29518260, 30344260	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	27174941, 31810462		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	15616792, 17662584, 21320869, 24123596, 26091074, 31699373		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	LHGDN	15616792		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	11097203	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	18081721, 27039800		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27039800	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12040448		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	25684469		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	25684469	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11216828, 24280140, 33593275, 34859099	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	16310260, 24358288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	17879021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	21142815, 22785600, 24280140, 27914007, 28043667, 28193608, 28378397, 28731675, 29121663, 29752300, 30019466, 30112065, 30118342, 30244779, 30317569, 30642049, 30763602, 30789913, 30977399, 31408234, 31808123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	22388798, 22785600, 30657570	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	LHGDN	18444803		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	20057160		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	36398072	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	21320869, 24123596		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	23378725, 28384717, 28630860, 29771404, 29803830, 30244069		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	Pubtator	23378725, 28630860, 37181702	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	Pubtator	32180680	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	22171077	Stimulate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	22171077		★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	26134542		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	26134542		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	12589095		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22391064, 23257253, 23987197		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23257253, 31893934	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12517806, 17079456, 17607721, 20461718, 20607722, 21880183, 23416081, 23637955, 24603891, 24703594, 25481674, 26407680, 26707908, 28881764, 28946771, 29693120, 31012106, 31243109, 31289527, 31410017, 31691433, 31850235		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	CTD_human_DG	20461718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21880183, 25066400, 26453114, 26617707, 29693120, 31691433, 33096744, 35689852, 37563232	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	CTD_human_DG	17607721		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	31243109, 36225172, 37915157	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	10027400, 10089944, 10100726, 10190290, 10438572, 10571406, 10598205, 10685633, 10741698, 10873080, 10896789, 10914717, 11220692, 11235952, 11368535, 11395366, 11469503, 11597382, 11764382, 11764385, 11792150, 11919158, 11920503, 11920583, 11935310, 12034400, 12133547, 12174360, 12184536, 12220955, 12235002, 12361907, 12438253, 12479698, 12566302, 12893436, 12941820, 1323219, 14520690, 14612977, 14631378, 15522912, 15538048, 15571322, 15581944, 15609121, 15665394, 15882758, 15998788, 16047212, 16198918, 16230396, 16230403, 16299238, 16515711, 16596214, 16618760, 16622457, 16685420, 16699496, 16718824, 16982764, 16985063, 17096843, 17131319, 17348445, 17599056, 17613170, 17908302, 18251742, 18292932, 18330957, 18339876, 18340378, 18349846, 18438431, 18506186, 18566996, 18579756, 18636172, 18708724, 19020732, 19117773, 19266599, 19303106, 19445018, 19540207, 19584266, 19610062, 19772879, 19903768, 20027628, 20060810, 20205165, 20371289, 20528747, 20571065, 20596657, 20881502, 21057533, 21104440, 21171825, 21331614, 21368903, 21380786, 21462187, 21637915, 21698233, 21968416, 22049175, 22076605, 22349830, 22524830, 22545131, 22555040, 22576800, 22581233, 22812190, 22901175, 23042506, 23070684, 23107277, 23109387, 23261456, 23280016, 23281640, 23298478, 23405233, 23696797, 23932289, 23970099, 23985780, 24164962, 24245968, 24325610, 24338375, 24535905, 24655550, 24670518, 24737028, 24885595, 24909183, 24929619, 25010662, 25071013, 25091190, 25100134, 25189759, 25308734, 25313763, 25469981, 25547485, 25596741, 25663465, 25735654, 25833691, 25888143, 26004948, 26099492, 26099922, 26148594, 26319608, 26526578, 26596835, 26599012, 26601990, 26880751, 26916087, 26938295, 27001612, 27039800, 27157622, 27406386, 27436149, 27458061, 27510461, 27569079, 27826041, 27922483, 28004430, 28043137, 28115251, 28131848, 28215146, 28234925, 28290666, 28296543, 28316241, 28371272, 28408249, 28419967, 28454222, 28454367, 28514710, 28529592, 28601470, 28616662, 28649130, 28707555, 28721066, 28752222, 28755734, 28766880, 28800785, 28824722, 28870072, 28960955, 29058417, 29065106, 29103203, 29104509, 29113219, 29128169, 29143522, 29151962, 29212855, 29260433, 29292171, 29312740, 29338907, 29416753, 29420334, 29458212, 29516917, 29521093, 29578156, 29588320, 29687772, 29721201, 29740240, 29770822, 29774068, 29848673, 29861633, 29917190, 29963137, 30109310, 30147314, 30175824, 30214563, 30248101, 30274301, 30307035, 30315637, 30396169, 30520325, 30548095, 30567534, 30581847, 30675244, 30688465, 30851455, 30904618, 30952722, 30972284, 31012354, 31019293, 31037134, 31076460, 31118763, 31141661, 31173237, 31201369, 31242439, 31293975, 31344491, 31354266, 31404330, 31410017, 31423502, 31465208, 31492006, 31576881, 31617997, 31618886, 31620202, 31637006, 31707727, 31777578, 31793787, 31820313, 7591268, 7591310, 7635566, 7961122, 7981891, 7992833, 8014015, 8015608, 9198203, 9255309, 9327744, 9349239, 9389934, 9490275, 9500469, 9610608, 9643688, 9785129, 9918199		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	21698233		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10726683, 11228100, 12085233, 15342394, 19540207, 23317647, 23563563, 28262117, 28382490, 29221117, 29241071		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19540207, 23563563, 23889963	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27589705	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28608207		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	LHGDN	16772717		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	10408538		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22072145		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	22072145	Associate	★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	HPO_DG			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26097608, 29856896, 30854350		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11844598, 17167724, 17208328, 22072145, 22455335, 22819774, 23457587, 24318272, 25337249, 25636510, 25659977, 25975224, 26758192, 27224551, 27447710, 28365695, 28392461, 28501870, 28915603, 29048613, 29312740, 29725453, 29783929, 30499104, 30551552, 30564960, 31124298		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	18265895		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	29753068		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	16807982		★☆☆☆☆ Found in Text Mining only
Nose Neoplasms	Nose Cancer	CTD_human_DG	16178123		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18182154, 19466389, 37181702, 39940809	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18184904, 19466389, 22828941, 23242659, 26097608, 29524577, 30135249		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34632798	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	26097608	Associate	★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	39769228	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	26298319		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	30344260	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	21958210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	14730609, 16806998, 19303468, 23965235, 24067484, 24223987, 34208590, 34353059, 35093162, 36471753	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23780780	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	33903094	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	17299841		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	18802702		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30317635		★☆☆☆☆ Found in Text Mining only
Osteolysis hereditary multicentric	Osteolysis, hereditary multicentric	Pubtator	17059372, 18985071, 31268248, 37710205	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteonecrosis	Osteonecrosis	Pubtator	22287106	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	BEFREE	17400654, 17440987, 24385215, 31032961		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	CTD_human_DG	17440987		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	18469019, 30186405		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10429943, 15049011, 16327977, 18757369, 21750404, 22387266, 22923031, 23900236, 24037915, 24190483, 25530132, 25605016, 25663465, 25728753, 25987128, 26062523, 26754027, 26979530, 27568842, 29042962, 29960050, 31708095		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	11346466, 21750404, 23886165, 23900236, 23940627, 24190483, 25663465, 26823829, 26979530, 27144433, 28750740, 29048621, 31446795, 32033398, 36177059, 38217543, 38538251	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	LHGDN	18757369		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	25605016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Otitis Media	Otitis media	BEFREE	31086579		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	LHGDN	16413616		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23915071		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	16213873		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	25482733		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	11748988, 17962725, 18340378		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15781636, 18340378, 19324884, 22579115, 22595649, 22832979, 24245968, 25347277, 26099492, 28571726, 29721047, 30182276, 31282404		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11355948, 15557756, 17314270, 18976802, 19324884, 20124444, 20607860, 20649989, 21151448, 21193558, 22471482, 22511598, 22652451, 24245968, 24408020, 25347277, 27038607, 28401704, 30469078, 31282404, 32706063, 32718331, 35621926, 35650297	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23714001, 28627617, 32547317	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	17343740, 19324884		★☆☆☆☆ Found in Text Mining only
Panacinar Emphysema	Panacinar emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12167581, 15257104, 15349101, 15492268, 17140727, 19056927, 19266599, 20482858, 23712777, 23745588, 24511528, 25017645, 25550789, 25863127, 25883224, 26866436, 27459514, 28284058, 29355139, 30352219, 30466735, 30719232, 30720116, 30803757, 30958531, 31060006, 31404611, 31441002, 7635566, 9349239		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	11854622, 12632066, 17377415, 17545513, 19116140		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	19266599, 28806504		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	30603057		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14760765, 15479693, 19056927, 19266599, 21448903, 22901124, 23538603, 23992308, 24008827, 24354864, 24511528, 25017645, 25137018, 25170871, 25215932, 25268648, 25550789, 25755762, 25883224, 26135631, 26850699, 28284058, 28368050, 28393239, 29157747, 29355139, 30720116, 31038558, 31404611, 34114996, 35107490	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis Chronic	Pancreatitis	Pubtator	30680957	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23685894, 28731152, 29128169, 29949618, 31363007		★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parapsoriasis	Parapsoriasis	Pubtator	20625418	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	10598205		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	10598205		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26844501		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26844501, 31085228	Associate	★☆☆☆☆ Found in Text Mining only
Parotitis	Parotitis	LHGDN	17237723		★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	23557756	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29304073		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	15547092		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	23242659		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	18937938	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	18274672, 26927240		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	24343133, 26927240	Stimulate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	28656271	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	28591659, 30213073		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	10776921, 25826490, 26821679, 35363329	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	16018746		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	16018746, 27095260, 27194818, 28043014, 28776753, 29315565, 29900539, 31032961, 31497543		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26821679	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21403096, 28715234, 30773823		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	21403096		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28715234		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	28593951, 31579944		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	15302515, 31650486		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	27909812, 8391548		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	27594586		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	12714657, 18552985		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	16198918, 28500926, 28680051		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	16167532, 26286316	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	17096843		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	LHGDN	17611666		★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	28088269		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	11422734	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	16338908		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22618590, 30989649		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34632798, 39796177	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35551681	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	25684469		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	25684469	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	16097959		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	LHGDN	12471459		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	22259225		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18829111		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28719899		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	25482733		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28984595, 30412498		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	16164636		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	23809662		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	26071077		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	12714657, 18552985, 28627654		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	30259634		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	31201369	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12361907, 12697668, 14598888, 15356679, 16407830, 16956360, 18398039, 18612129, 19117773, 19303106, 19578386, 19633975, 19638505, 19819277, 20160036, 20207476, 21219645, 21248144, 21649463, 22200661, 22374248, 22555040, 22573553, 23424616, 24453046, 24475196, 25154741, 25310386, 25577646, 25917126, 26319608, 26564800, 27329245, 27541146, 27931798, 28122633, 28445160, 29107109, 29175302, 29300772, 29358129, 29440967, 30294801, 30520325, 30917169, 8417833, 9950685		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	27931798		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	22555040, 27331624	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	26564800		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	30999385		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14679018, 16407830, 16888681, 18329693, 18618693, 18852494		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	14760014, 15928670, 19578386, 20160036, 22555040, 23424616, 23766685, 24386413, 24589892, 25623427, 26312765, 26564800, 26742965, 29300772, 30520325, 30864712, 32692888, 35650297, 9950685	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15280448, 17131319, 23673480, 27035428, 8561867		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	LHGDN	15955448		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	Pubtator	15955448	Associate	★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	19575173, 20541540		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11069613, 12077518, 19360430		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27088930	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	19420332		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	15863640	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33334933	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20075389, 20078883, 26126526, 26439471, 36221131	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33070147	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	17099140, 29428733, 30993494, 9759652		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15651999, 23973652, 31509566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	15651999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	15651999	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	21468558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	20636397	Associate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	21658319	Stimulate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21531813, 29578156		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	24118356		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	25273173		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12684625, 18644390		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15067327, 15882758, 16596214, 17541305, 19448672, 21808237, 23281640, 25571919, 25588050, 27806310, 28277191, 28487942, 30224058, 31217736		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24333535, 28219345, 28885334		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	24980077		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	28662821		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31311916		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	30025117		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	19345729, 31100326		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	23791966, 31843793		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31810025		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	23077401, 27488116, 30024608, 32152631	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30024608		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	29312345		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15120641, 23900236, 24190483		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10830778, 11678909, 11824946, 11959761, 15781326, 16356191, 16507143, 16967187, 17697361, 18205826, 18796608, 22532631, 22960198, 24065540, 24309559, 26436849, 28017911, 28518078, 28901438, 29475075, 31012109, 31234900, 31425817, 9923652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15248212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	16872482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	25412957, 27569079	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathy	BEFREE	28821434		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	21959615		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21959615	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	11249053, 19875755, 21983934, 23661254, 23900236, 24085323, 24190483, 25436070, 31510956	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24190483		★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	10450179	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	28498412		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24982919, 31268248, 33334933	Associate	★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	10353746		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	38069214	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21671855		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	23378725		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	28118356		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30707337		★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	29431912		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	17400654		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	18042068		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	25753939	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	25753939		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11798192, 17018612, 24722482		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	19643940, 19903768, 24722482, 26050228, 35441564	Associate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30903721		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	31486131		★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	30067795		★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	28088269		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10362121, 11235994, 12579321, 15756447, 16142392, 16391805, 18349846, 20664935, 22576800, 24210072, 24658023, 25202075, 31686863, 7744701, 9924429		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12029498, 12194986, 12479097, 12632084, 14990972, 15254682, 15756447, 16142392, 16424893		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15069682, 15492291, 19562509, 21603862, 22433565, 22522455, 25407307, 25724186, 25966235, 25976624, 27057634, 28488526, 29306013, 30106155, 31216681, 31599475		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12404284, 15247230, 16424893, 18349846, 18853752, 19241124, 21174909, 23107277, 24658023, 25117810, 26036622, 26666815, 26874697, 27021541, 27853937, 29719198, 31263828, 31799662, 31882488, 32397656, 32471980, 32934875, 32961679, 34636197, 35951144, 37116157, 38030062	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15274394	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26434905	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	19525975		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10755382, 10840163, 10987249, 15523429, 16275157, 16515711, 21380786, 21958210, 23122824, 25091190, 25202075, 30987217, 8988738		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28559016, 31827393		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29685010		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	17706812, 18035073, 29685010		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	10971173		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	LHGDN	15449075		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12673424, 15929171, 16718824, 17236757, 17486447, 18330957, 20333791, 20360147, 20514448, 21612407, 22460086, 23736018, 23901223, 24072772, 24130168, 26291058, 27291049, 29262634, 29783070, 31218131, 31841039		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12172043, 12174360, 12460468, 15929171, 16718824, 16731602, 16940985, 17094486, 18468407, 19586554, 20333791, 20563765, 20950454, 21052891, 21483125, 21777278, 22460086, 23058008, 23058013, 23289017, 23534724, 23736018, 23797661, 24441189, 24800696, 24905806, 25921630, 26271669, 26291058, 26652716, 27384994, 28347236, 28621235, 29808160, 31556767, 31766266, 32020871, 33773545, 34885656, 35397606, 35650297, 35705840, 36580668, 37565919, 37573302, 9499190, 9681807	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15929171, 17486447, 18283635, 18330957, 18498066		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18330957, 24669030, 40597264	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19292924, 20222942, 28193703, 30278505	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29880550		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	20636397, 21658319	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30707337		★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	11895494		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	23661254, 30707337		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11062605, 31268248	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12007723, 20110530, 24982919, 9373715		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	12007723, 17493602		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	LHGDN	12952836		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	23235385		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	29620182		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	CTD_human_DG	22321834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	30655554		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	25684469		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	12393408, 23127983, 40724896	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	22871832, 29521049		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	36156766	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	20306451	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22820140, 23685894, 24667444, 24778099, 28731152, 30272290	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21493587, 22042554, 24106286, 26312762, 26695142, 28393241, 28709407, 9545106		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	29734379	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	25812648	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18651826, 18652765, 18664479		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21493587, 22042554, 24106286, 26312762, 26695142, 28709407		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17158762, 19589279, 20306451, 21493587, 22641097, 27082011, 28709407, 35849996	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	23685894, 25812648		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	22820140	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	21174909, 27431199	Associate	★☆☆☆☆ Found in Text Mining only
TORG-WINCHESTER SYNDROME	TORG-WINCHESTER SYNDROME	UNIPROT_DG	11431697, 15691365, 16542393		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TORG-WINCHESTER SYNDROME	TORG-WINCHESTER SYNDROME	BEFREE	17059372, 17563705, 19653001, 20560960, 20720557, 24637309, 25273674, 26601801, 31268248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TORG-WINCHESTER SYNDROME	TORG-WINCHESTER SYNDROME	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TORG-WINCHESTER SYNDROME	TORG-WINCHESTER SYNDROME	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TORG-WINCHESTER SYNDROME	TORG-WINCHESTER SYNDROME	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	24189491		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	25772244	Stimulate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12133547		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	28750369		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26537583, 27038254, 32242230, 32332626, 32582965, 34787047, 37217473, 37879215, 39819723	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29414799		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34108545	Stimulate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	19395678		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	15545515, 21193197		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27664275, 28854064		★☆☆☆☆ Found in Text Mining only
Unilateral Cryptorchidism	Cryptorchidism	BEFREE	31295049		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	29891747		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	37867197	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	21931970, 25402510	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20586027, 22960341, 24448324, 24573199, 25884322, 27317771, 27631965, 28846829, 29237912, 31401412, 33234027, 33604385, 33650650, 34354794, 35563650, 35777025, 36293387, 37932474	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	26307680		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16619570, 20109015, 24804816	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	17671679		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	18210196, 29770331		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10486468, 11710594, 15989693, 16619570, 16788844, 16803520, 23679328, 23922932, 23967226, 24804816, 25250801, 26148476, 26191191, 26332389, 26526578, 26561467, 26802645, 29267213, 29610452, 29789601, 30158710, 30484490, 31007650, 31026389, 31180057, 31638249, 32669083, 36088372, 40603406	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15665394, 22438955	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	25398968, 30015921		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	11371496, 25184134, 27255356, 34587931	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	28455241		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	18971037	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	19703751, 24785109, 28818228, 32096196, 32594304	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	24505358	Inhibit	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	21576412, 24785109, 31738197		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	23151010	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12975253		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	38203296	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	25120286, 35372112	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	31254341	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	17898039	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	25004843		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	11700497	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	32156832, 35107490	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	21817815, 27126693	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Winchester syndrome	Winchester syndrome	Pubtator	17059372	Associate	★☆☆☆☆ Found in Text Mining only
Winchester syndrome (disorder)	Winchester syndrome	BEFREE	15691365, 16542393, 17059372		★☆☆☆☆ Found in Text Mining only