MKRN4P (makorin ring finger protein 4, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 7682
Gene name Makorin ring finger protein 4, pseudogene
Gene symbol MKRN4P
Synonyms (NCBI Gene)
MKRN4MKRNP5RNF64ZNF-XpZNF127-XpZNF127L1
Chromosome X
Chromosome location Xp11.4
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IEA
GO:0008270 Function Zinc ion binding IEA
GO:0016567 Process Protein ubiquitination IBA
GO:0016567 Process Protein ubiquitination IEA
GO:0016740 Function Transferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 7115 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13434
Protein name Putative E3 ubiquitin-protein ligase makorin-4 (EC 2.3.2.27) (Makorin RING finger protein pseudogene 4) (Makorin RING finger protein pseudogene 5) (RING finger protein 64) (RING-type E3 ubiquitin transferase makorin-4) (Zinc finger protein 127-Xp) (ZNF127
Protein function May act as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00097 zf-C3HC4 316 → 369 Zinc finger, C3HC4 type (RING finger) Domain
PF15815 MKRN1_C 427 → 485 E3 ubiquitin-protein ligase makorin, C-terminal Domain
PF18044 zf-CCCH_4 247 → 268 CCCH-type zinc finger Domain
PF18044 zf-CCCH_4 94 → 115 CCCH-type zinc finger Domain
PF14608 zf-CCCH_2 404 → 425 Domain
Sequence 
MAEAAAPGTTVTTSGAGAAAAEAAETAEAVSPTPIPTVTAPSPRAGGGVGGSDGSDGSGG
RGDSGAYDGSGACGGSDACDGSGDSSGDSWTKQVTCRYFKYGICKEGDNCRYSHDLSDRL
CGVVCKYFQRGCCVYGDRCRCEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMN
TNEAESRNSNFATVVAGSEDWANAIEFVPGQPYCGRTVPSCTEAPLQGSVTKEESEEEQT
AVETKKQLCPYAAVGQCRYGENCVYLHGDLCDMCGLQVLHPMDAAQRSQHIQACIEAHEK
DMEFSFAVQRSKDKVCGICMEVVYEKANPNEHRFGILSNCNHTFCLKCIRKWRSAKEFES
RIVKSCPQCRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACKYFDEGRGSCPFGEN
CFYKHMYPDGRREEPQRQQVGTSSRNPGQQRNHFWEFFEEGANSNPFDDEEEAVTFELGE
MLLML
Sequence length 485
Interactions View interactions

No strongly related genes found yet for MKRN4P.

No additional diseases found yet through genes similar to MKRN4P.