MISP (mitotic spindle positioning)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 126353
• Gene name: Mitotic spindle positioning
• Gene symbol: MISP
• Synonyms (NCBI Gene): C19orf21, MISP1
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The protein encoded by this gene is an actin-bundling protein involved in determining cell morphology and mitotic progression. The encoded protein is required for the proper positioning of the mitotic spindle. Two transcript variants, one protein-coding a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017782	hsa-miR-335-5p	Microarray	18185580
MIRT022655	hsa-miR-124-3p	Proteomics;Microarray	18668037

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	23509069, 23574715
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	23509069, 23574715, 28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IMP	23574715
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	IDA
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	IMP	23509069
GO:0005925	Component	Focal adhesion	IMP	23574715
GO:0005938	Component	Cell cortex	IEA
GO:0016477	Process	Cell migration	IMP	23574715
GO:0030864	Component	Cortical actin cytoskeleton	IMP	23509069
GO:0031616	Component	Spindle pole centrosome	IMP	23574715
GO:0051015	Function	Actin filament binding	IMP	23509069
GO:0051301	Process	Cell division	IEA
GO:0051640	Process	Organelle localization	IMP	23574715
GO:0051660	Process	Establishment of centrosome localization	IMP	23509069, 23574715
GO:0070161	Component	Anchoring junction	IEA
GO:0090307	Process	Mitotic spindle assembly	IMP	23574715
GO:1904776	Process	Regulation of protein localization to cell cortex	IMP	23509069
GO:1905721	Component	Mitotic spindle astral microtubule end	IMP	23509069

Other IDs

• MIM: 615289
• HGNC: 27000
• e!Ensembl: ENSG00000099812

Protein

• UniProt ID: Q8IVT2
• Protein name: Mitotic interactor and substrate of PLK1 (Mitotic spindle positioning protein)
• Protein function: Plays a role in mitotic spindle orientation and mitotic progression. Regulates the distribution of dynactin at the cell cortex in a PLK1-dependent manner, thus stabilizing cortical and astral microtubule attachments required for proper mitotic s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15304	AKAP2_C	325 → 674	A-kinase anchor protein 2 C-terminus	Family

• Sequence:

  MDRVTRYPILGIPQAHRGTGLVLDGDTSYTYHLVCMGPEASGWGQDEPQTWPTDHRAQQG
  VQRQGVSYSVHAYTGQPSPRGLHSENREDEGWQVYRLGARDAHQGRPTWALRPEDGEDKE
  MKTYRLDAGDADPRRLCDLERERWAVIQGQAVRKSSTVATLQGTPDHGDPRTPGPPRSTP
  LEENVVDREQIDFLAARQQFLSLEQANKGAPHSSPARGTPAGTTPGASQAPKAFNKPHLA
  NGHVVPIKPQVKGVVREENKVRAVPTWASVQVVDDPGSLASVESPGTPKETPIEREIRLA
  QEREADLREQRGLRQATDHQELVEIPTRPLLTKLSLITAPRRERGRPSLYVQRDIVQETQ
  REEDHRREGLHVGRASTPDWVSEGPQPGLRRALSSDSILSPAPDARAADPAPEVRKVNRI
  PPDAYQPYLSPGTPQLEFSAFGAFGKPSSLSTAEAKAATSPKATMSPRHLSESSGKPLST
  KQEASKPPRGCPQANRGVVRWEYFRLRPLRFRAPDEPQQAQVPHVWGWEVAGAPALRLQK
  SQSSDLLERERESVLRREQEVAEERRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYS
  VSESPFFSPIHLHSNVAWTVEDPVDSAPPGQRKKEQWYAGINPSDGINSEVLEAIRVTRH
  KNAMAERWESRIYASEEDD

• Sequence length: 679

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29348144		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29098164	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29098164		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for MISP.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MISP.