MIS12 (MIS12 kinetochore complex component)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79003
• Gene name: MIS12 kinetochore complex component
• Gene symbol: MIS12
• Synonyms (NCBI Gene): 2510025F08Rik, KNTC2AP, MTW1, hMis12
• Chromosome: 17
• Chromosome location: 17p13.2

miRNA Show/Hide all (262)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004855	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR	19074876
MIRT024957	hsa-miR-215-5p	Microarray	19074876
MIRT004855	hsa-miR-192-5p	Reporter assay;Microarray;Other	19074876
MIRT028251	hsa-miR-32-5p	Sequencing	20371350
MIRT051265	hsa-miR-16-5p	CLASH	23622248
MIRT047693	hsa-miR-10a-5p	CLASH	23622248
MIRT1149421	hsa-miR-1197	CLIP-seq
MIRT1149422	hsa-miR-1225-3p	CLIP-seq
MIRT1149423	hsa-miR-1227	CLIP-seq
MIRT1149424	hsa-miR-1233	CLIP-seq
MIRT1149425	hsa-miR-1262	CLIP-seq
MIRT1149426	hsa-miR-1287	CLIP-seq
MIRT1149427	hsa-miR-129-5p	CLIP-seq
MIRT1149428	hsa-miR-132	CLIP-seq
MIRT1149429	hsa-miR-1825	CLIP-seq
MIRT1149430	hsa-miR-1827	CLIP-seq
MIRT1149431	hsa-miR-186	CLIP-seq
MIRT1149432	hsa-miR-1910	CLIP-seq
MIRT1149433	hsa-miR-199a-5p	CLIP-seq
MIRT1149434	hsa-miR-199b-5p	CLIP-seq
MIRT1149435	hsa-miR-2115	CLIP-seq
MIRT1149436	hsa-miR-212	CLIP-seq
MIRT1149437	hsa-miR-300	CLIP-seq
MIRT1149438	hsa-miR-3125	CLIP-seq
MIRT1149439	hsa-miR-3133	CLIP-seq
MIRT1149440	hsa-miR-3135b	CLIP-seq
MIRT1149441	hsa-miR-3140-3p	CLIP-seq
MIRT1149442	hsa-miR-3145-5p	CLIP-seq
MIRT1149443	hsa-miR-3182	CLIP-seq
MIRT1149444	hsa-miR-3613-3p	CLIP-seq
MIRT1149445	hsa-miR-3614-5p	CLIP-seq
MIRT1149446	hsa-miR-3617	CLIP-seq
MIRT1149447	hsa-miR-3649	CLIP-seq
MIRT1149448	hsa-miR-3682-5p	CLIP-seq
MIRT1149449	hsa-miR-3689a-3p	CLIP-seq
MIRT1149450	hsa-miR-3689c	CLIP-seq
MIRT1149451	hsa-miR-371-5p	CLIP-seq
MIRT1149452	hsa-miR-371b-5p	CLIP-seq
MIRT1149453	hsa-miR-378	CLIP-seq
MIRT1149454	hsa-miR-378b	CLIP-seq
MIRT1149455	hsa-miR-378c	CLIP-seq
MIRT1149456	hsa-miR-378d	CLIP-seq
MIRT1149457	hsa-miR-378e	CLIP-seq
MIRT1149458	hsa-miR-378f	CLIP-seq
MIRT1149459	hsa-miR-378h	CLIP-seq
MIRT1149460	hsa-miR-378i	CLIP-seq
MIRT1149461	hsa-miR-381	CLIP-seq
MIRT1149462	hsa-miR-3916	CLIP-seq
MIRT1149463	hsa-miR-3925-3p	CLIP-seq
MIRT1149464	hsa-miR-3929	CLIP-seq
MIRT1149465	hsa-miR-3974	CLIP-seq
MIRT1149466	hsa-miR-422a	CLIP-seq
MIRT1149467	hsa-miR-4252	CLIP-seq
MIRT1149468	hsa-miR-4317	CLIP-seq
MIRT1149469	hsa-miR-4419b	CLIP-seq
MIRT1149470	hsa-miR-4436a	CLIP-seq
MIRT1149471	hsa-miR-4459	CLIP-seq
MIRT1149472	hsa-miR-4475	CLIP-seq
MIRT1149473	hsa-miR-4478	CLIP-seq
MIRT1149474	hsa-miR-4521	CLIP-seq
MIRT1149475	hsa-miR-4649-3p	CLIP-seq
MIRT1149476	hsa-miR-4701-3p	CLIP-seq
MIRT1149477	hsa-miR-4704-3p	CLIP-seq
MIRT1149478	hsa-miR-4722-5p	CLIP-seq
MIRT1149479	hsa-miR-4728-5p	CLIP-seq
MIRT1149480	hsa-miR-4774-5p	CLIP-seq
MIRT1149481	hsa-miR-4777-3p	CLIP-seq
MIRT1149482	hsa-miR-4796-3p	CLIP-seq
MIRT1149483	hsa-miR-4800-5p	CLIP-seq
MIRT1149484	hsa-miR-485-3p	CLIP-seq
MIRT1149485	hsa-miR-485-5p	CLIP-seq
MIRT1149486	hsa-miR-490-3p	CLIP-seq
MIRT1149487	hsa-miR-508-5p	CLIP-seq
MIRT1149488	hsa-miR-5095	CLIP-seq
MIRT1149489	hsa-miR-516a-3p	CLIP-seq
MIRT1149490	hsa-miR-518a-5p	CLIP-seq
MIRT1149491	hsa-miR-520g	CLIP-seq
MIRT1149492	hsa-miR-520h	CLIP-seq
MIRT1149493	hsa-miR-527	CLIP-seq
MIRT1149494	hsa-miR-542-3p	CLIP-seq
MIRT1149495	hsa-miR-545	CLIP-seq
MIRT1149496	hsa-miR-570	CLIP-seq
MIRT1149497	hsa-miR-583	CLIP-seq
MIRT1149498	hsa-miR-584	CLIP-seq
MIRT1149499	hsa-miR-641	CLIP-seq
MIRT1149500	hsa-miR-649	CLIP-seq
MIRT1149501	hsa-miR-875-5p	CLIP-seq
MIRT1149502	hsa-miR-890	CLIP-seq
MIRT1149503	hsa-miR-940	CLIP-seq
MIRT1149427	hsa-miR-129-5p	CLIP-seq
MIRT1149428	hsa-miR-132	CLIP-seq
MIRT1149432	hsa-miR-1910	CLIP-seq
MIRT1149436	hsa-miR-212	CLIP-seq
MIRT1149442	hsa-miR-3145-5p	CLIP-seq
MIRT2042506	hsa-miR-3155	CLIP-seq
MIRT2042507	hsa-miR-3155b	CLIP-seq
MIRT1149446	hsa-miR-3617	CLIP-seq
MIRT1149449	hsa-miR-3689a-3p	CLIP-seq
MIRT1149450	hsa-miR-3689c	CLIP-seq
MIRT2042508	hsa-miR-4438	CLIP-seq
MIRT2042509	hsa-miR-4477a	CLIP-seq
MIRT1149479	hsa-miR-4728-5p	CLIP-seq
MIRT2042510	hsa-miR-484	CLIP-seq
MIRT1149498	hsa-miR-584	CLIP-seq
MIRT1149499	hsa-miR-641	CLIP-seq
MIRT1149502	hsa-miR-890	CLIP-seq
MIRT1149421	hsa-miR-1197	CLIP-seq
MIRT1149422	hsa-miR-1225-3p	CLIP-seq
MIRT1149424	hsa-miR-1233	CLIP-seq
MIRT1149428	hsa-miR-132	CLIP-seq
MIRT1149430	hsa-miR-1827	CLIP-seq
MIRT1149436	hsa-miR-212	CLIP-seq
MIRT2272157	hsa-miR-3157-5p	CLIP-seq
MIRT1149445	hsa-miR-3614-5p	CLIP-seq
MIRT1149449	hsa-miR-3689a-3p	CLIP-seq
MIRT1149450	hsa-miR-3689c	CLIP-seq
MIRT1149464	hsa-miR-3929	CLIP-seq
MIRT2272158	hsa-miR-3973	CLIP-seq
MIRT2272159	hsa-miR-3977	CLIP-seq
MIRT2272160	hsa-miR-4257	CLIP-seq
MIRT1149469	hsa-miR-4419b	CLIP-seq
MIRT1149470	hsa-miR-4436a	CLIP-seq
MIRT1149471	hsa-miR-4459	CLIP-seq
MIRT1149473	hsa-miR-4478	CLIP-seq
MIRT1149475	hsa-miR-4649-3p	CLIP-seq
MIRT1149478	hsa-miR-4722-5p	CLIP-seq
MIRT1149479	hsa-miR-4728-5p	CLIP-seq
MIRT2272161	hsa-miR-4731-3p	CLIP-seq
MIRT2272162	hsa-miR-4801	CLIP-seq
MIRT1149485	hsa-miR-485-5p	CLIP-seq
MIRT1149491	hsa-miR-520g	CLIP-seq
MIRT1149492	hsa-miR-520h	CLIP-seq
MIRT1149498	hsa-miR-584	CLIP-seq
MIRT1149502	hsa-miR-890	CLIP-seq
MIRT1149503	hsa-miR-940	CLIP-seq
MIRT1149421	hsa-miR-1197	CLIP-seq
MIRT1149422	hsa-miR-1225-3p	CLIP-seq
MIRT1149424	hsa-miR-1233	CLIP-seq
MIRT1149430	hsa-miR-1827	CLIP-seq
MIRT1149445	hsa-miR-3614-5p	CLIP-seq
MIRT1149449	hsa-miR-3689a-3p	CLIP-seq
MIRT1149450	hsa-miR-3689c	CLIP-seq
MIRT1149464	hsa-miR-3929	CLIP-seq
MIRT1149469	hsa-miR-4419b	CLIP-seq
MIRT1149470	hsa-miR-4436a	CLIP-seq
MIRT1149471	hsa-miR-4459	CLIP-seq
MIRT1149473	hsa-miR-4478	CLIP-seq
MIRT1149475	hsa-miR-4649-3p	CLIP-seq
MIRT1149478	hsa-miR-4722-5p	CLIP-seq
MIRT1149479	hsa-miR-4728-5p	CLIP-seq
MIRT1149485	hsa-miR-485-5p	CLIP-seq
MIRT1149502	hsa-miR-890	CLIP-seq
MIRT1149503	hsa-miR-940	CLIP-seq
MIRT2454149	hsa-miR-330-3p	CLIP-seq
MIRT2454150	hsa-miR-4762-5p	CLIP-seq
MIRT2454151	hsa-miR-548l	CLIP-seq
MIRT2454152	hsa-miR-548n	CLIP-seq
MIRT1149421	hsa-miR-1197	CLIP-seq
MIRT1149422	hsa-miR-1225-3p	CLIP-seq
MIRT1149423	hsa-miR-1227	CLIP-seq
MIRT1149424	hsa-miR-1233	CLIP-seq
MIRT2571168	hsa-miR-1254	CLIP-seq
MIRT1149425	hsa-miR-1262	CLIP-seq
MIRT2571169	hsa-miR-1276	CLIP-seq
MIRT1149426	hsa-miR-1287	CLIP-seq
MIRT1149430	hsa-miR-1827	CLIP-seq
MIRT2571170	hsa-miR-27a	CLIP-seq
MIRT2571171	hsa-miR-27b	CLIP-seq
MIRT2571172	hsa-miR-3116	CLIP-seq
MIRT1149440	hsa-miR-3135b	CLIP-seq
MIRT2571173	hsa-miR-3174	CLIP-seq
MIRT1149443	hsa-miR-3182	CLIP-seq
MIRT2571174	hsa-miR-338-5p	CLIP-seq
MIRT1149445	hsa-miR-3614-5p	CLIP-seq
MIRT2571175	hsa-miR-3647-3p	CLIP-seq
MIRT1149449	hsa-miR-3689a-3p	CLIP-seq
MIRT1149450	hsa-miR-3689c	CLIP-seq
MIRT2571176	hsa-miR-3690	CLIP-seq
MIRT1149453	hsa-miR-378	CLIP-seq
MIRT1149454	hsa-miR-378b	CLIP-seq
MIRT1149455	hsa-miR-378c	CLIP-seq
MIRT1149456	hsa-miR-378d	CLIP-seq
MIRT1149457	hsa-miR-378e	CLIP-seq
MIRT1149458	hsa-miR-378f	CLIP-seq
MIRT1149459	hsa-miR-378h	CLIP-seq
MIRT1149460	hsa-miR-378i	CLIP-seq
MIRT1149464	hsa-miR-3929	CLIP-seq
MIRT1149465	hsa-miR-3974	CLIP-seq
MIRT1149466	hsa-miR-422a	CLIP-seq
MIRT1149467	hsa-miR-4252	CLIP-seq
MIRT2272160	hsa-miR-4257	CLIP-seq
MIRT2571177	hsa-miR-4316	CLIP-seq
MIRT1149469	hsa-miR-4419b	CLIP-seq
MIRT1149470	hsa-miR-4436a	CLIP-seq
MIRT1149471	hsa-miR-4459	CLIP-seq
MIRT2571178	hsa-miR-4462	CLIP-seq
MIRT2571179	hsa-miR-4469	CLIP-seq
MIRT1149473	hsa-miR-4478	CLIP-seq
MIRT1149474	hsa-miR-4521	CLIP-seq
MIRT2571180	hsa-miR-4638-3p	CLIP-seq
MIRT1149475	hsa-miR-4649-3p	CLIP-seq
MIRT2571181	hsa-miR-4687-3p	CLIP-seq
MIRT2571182	hsa-miR-4700-3p	CLIP-seq
MIRT1149476	hsa-miR-4701-3p	CLIP-seq
MIRT1149478	hsa-miR-4722-5p	CLIP-seq
MIRT1149479	hsa-miR-4728-5p	CLIP-seq
MIRT2571183	hsa-miR-4781-3p	CLIP-seq
MIRT1149485	hsa-miR-485-5p	CLIP-seq
MIRT1149486	hsa-miR-490-3p	CLIP-seq
MIRT2571184	hsa-miR-512-5p	CLIP-seq
MIRT2571185	hsa-miR-513a-5p	CLIP-seq
MIRT1149494	hsa-miR-542-3p	CLIP-seq
MIRT2571186	hsa-miR-647	CLIP-seq
MIRT1149500	hsa-miR-649	CLIP-seq
MIRT1149502	hsa-miR-890	CLIP-seq
MIRT2571187	hsa-miR-921	CLIP-seq
MIRT1149503	hsa-miR-940	CLIP-seq
MIRT1149421	hsa-miR-1197	CLIP-seq
MIRT1149422	hsa-miR-1225-3p	CLIP-seq
MIRT1149423	hsa-miR-1227	CLIP-seq
MIRT1149424	hsa-miR-1233	CLIP-seq
MIRT2571168	hsa-miR-1254	CLIP-seq
MIRT1149425	hsa-miR-1262	CLIP-seq
MIRT2571169	hsa-miR-1276	CLIP-seq
MIRT1149430	hsa-miR-1827	CLIP-seq
MIRT2571170	hsa-miR-27a	CLIP-seq
MIRT2571171	hsa-miR-27b	CLIP-seq
MIRT2571172	hsa-miR-3116	CLIP-seq
MIRT2571174	hsa-miR-338-5p	CLIP-seq
MIRT1149445	hsa-miR-3614-5p	CLIP-seq
MIRT2571175	hsa-miR-3647-3p	CLIP-seq
MIRT1149447	hsa-miR-3649	CLIP-seq
MIRT1149449	hsa-miR-3689a-3p	CLIP-seq
MIRT1149450	hsa-miR-3689c	CLIP-seq
MIRT2571176	hsa-miR-3690	CLIP-seq
MIRT1149464	hsa-miR-3929	CLIP-seq
MIRT1149467	hsa-miR-4252	CLIP-seq
MIRT2272160	hsa-miR-4257	CLIP-seq
MIRT1149469	hsa-miR-4419b	CLIP-seq
MIRT1149470	hsa-miR-4436a	CLIP-seq
MIRT1149471	hsa-miR-4459	CLIP-seq
MIRT2571178	hsa-miR-4462	CLIP-seq
MIRT2571179	hsa-miR-4469	CLIP-seq
MIRT1149472	hsa-miR-4475	CLIP-seq
MIRT1149473	hsa-miR-4478	CLIP-seq
MIRT2571180	hsa-miR-4638-3p	CLIP-seq
MIRT1149475	hsa-miR-4649-3p	CLIP-seq
MIRT2571181	hsa-miR-4687-3p	CLIP-seq
MIRT2571182	hsa-miR-4700-3p	CLIP-seq
MIRT1149476	hsa-miR-4701-3p	CLIP-seq
MIRT1149478	hsa-miR-4722-5p	CLIP-seq
MIRT1149479	hsa-miR-4728-5p	CLIP-seq
MIRT2571183	hsa-miR-4781-3p	CLIP-seq
MIRT1149485	hsa-miR-485-5p	CLIP-seq
MIRT1149486	hsa-miR-490-3p	CLIP-seq
MIRT2571184	hsa-miR-512-5p	CLIP-seq
MIRT2571185	hsa-miR-513a-5p	CLIP-seq
MIRT1149494	hsa-miR-542-3p	CLIP-seq
MIRT2571186	hsa-miR-647	CLIP-seq
MIRT1149500	hsa-miR-649	CLIP-seq
MIRT1149502	hsa-miR-890	CLIP-seq
MIRT1149503	hsa-miR-940	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IBA
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000444	Component	MIS12/MIND type complex	IBA
GO:0000444	Component	MIS12/MIND type complex	IDA	16585270, 20819937, 27881301
GO:0000444	Component	MIS12/MIND type complex	NAS	21633384
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	15371340
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	NAS	21633384, 23418356
GO:0000922	Component	Spindle pole	NAS	21633384
GO:0000940	Component	Outer kinetochore	IDA	24530301
GO:0005515	Function	Protein binding	IPI	15371340, 15502821, 20360068, 23334297, 24981860, 25416956, 26496610, 27705803, 27881301, 28514442, 32296183, 33961781, 35271311, 37398436
GO:0005634	Component	Nucleus	IDA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	21633384
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	IMP	12515822, 16585270
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	NAS	21633384
GO:0051301	Process	Cell division	IEA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	23891108
GO:0051382	Process	Kinetochore assembly	IBA
GO:0051382	Process	Kinetochore assembly	IDA	16585270

Other IDs

• MIM: 609178
• HGNC: 24967
• e!Ensembl: ENSG00000167842

Protein

• UniProt ID: Q9H081
• Protein name: Protein MIS12 homolog
• Protein function: Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis (PubMed:12515822, PubMed:15502821, PubMed:16585270). Essential for proper kinetochore microtubule attachment
• PDB: 5LSJ , 5LSK , 8PPR , 8Q5H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05859	Mis12	8 → 140	Mis12 protein	Family

• Sequence:

  MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQI
  RKCTEKFLCFMKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKE
  IEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVS
  LVQNSRKLQNIRDNVEKESKRLKIS

• Sequence length: 205

Pathways

Reactome Pathway

Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal

Separation of Sister Chromatids

Resolution of Sister Chromatid Cohesion

RHO GTPases Activate Formins

Mitotic Prometaphase

EML4 and NUDC in mitotic spindle formation

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PMF1-BGLAP 6 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 6 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. NUDC 6 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 6 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. ZWINT 6 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 6 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. PMF1 6 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 6 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids. SPC24 6 shared pathwaysAmplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids, Resolution of Sister Chromatid Cohesion, RHO GTPases Activate Formins, Mitotic Prometaphase, EML4 and NUDC in mitotic spindle formation Related via 6 shared pathways including Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal, Separation of Sister Chromatids.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PMF1-BGLAP	0	[]	6	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
NUDC	0	[]	6	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
ZWINT	0	[]	6	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
PMF1	0	[]	6	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]
SPC24	0	[]	6	["Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation"]	0	[]

Diseases Linked via Similar Genes

Breast cancer Linked via 2 of 5 related genesPMF1-BGLAP, PMF1 Clear cell renal cell carcinoma Linked via 2 of 5 related genesPMF1-BGLAP, PMF1 Intracerebral hemorrhage Linked via 2 of 5 related genesPMF1-BGLAP, PMF1 Kidney cancer Linked via 2 of 5 related genesPMF1-BGLAP, PMF1 Myeloproliferative disorder Linked via 2 of 5 related genesPMF1-BGLAP, PMF1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Breast cancer	2	["PMF1-BGLAP","PMF1"]
Clear cell renal cell carcinoma	2	["PMF1-BGLAP","PMF1"]
Intracerebral hemorrhage	2	["PMF1-BGLAP","PMF1"]
Kidney cancer	2	["PMF1-BGLAP","PMF1"]
Myeloproliferative disorder	2	["PMF1-BGLAP","PMF1"]