MIR9-1HG (MIR9-1 host gene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10485
Gene name MIR9-1 host gene
Gene symbol MIR9-1HG
Synonyms (NCBI Gene)
C1orf61CROC4
Chromosome 1
Chromosome location 1q22
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus TAS 10995546
GO:0045944 Process Positive regulation of transcription by RNA polymerase II IDA 10995546
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618747 30780 ENSG00000125462
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13536
Protein name Protein CROC-4 (Contingent replication of cDNA 4) (MIR9-1 host gene)
Protein function May play a role in FOS signaling pathways involved in development and remodeling of neurons. Promotes transcription of the FOS promoter.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed throughout the brain in the thalamus, subthalamic nucleus, corpus callosum, hippocampus, substantia nigra, caudate nucleus, and amygdala. {ECO:0000269|PubMed:10995546}.
Sequence 
MFLTEDLITFNLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSS
PRPPGSTSHCGISTRCTERCLCVLPLRTSQVPDVMAPQHDQEKFHDLAYSCLGKSFSMSN
QDLYGYSTSSLALGLAWLSWETKKKNVLHLVGLDSL
Sequence length 156
Interactions View interactions

No strongly related genes found yet for MIR9-1HG.

No additional diseases found yet through genes similar to MIR9-1HG.