MIR7-3HG (MIR7-3 host gene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 284424 |
| Gene name | MIR7-3 host gene |
| Gene symbol | MIR7-3HG |
| Synonyms (NCBI Gene) |
C19orf30Huh7LINC00306NCRNA00306PGSF1uc002mbe.2
|
| Chromosome | 19 |
| Chromosome location | 19p13.3 |
|
miRNA
miRNA information provided by mirtarbase database.
1
|
|||||||||
|
|||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8N6C7 |
| Protein name | Putative uncharacterized protein encoded by MIR7-3HG (Pituitary gland-specific factor 1) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: High expression in pituitary gland and weak in pancreas. {ECO:0000269|PubMed:11854097}. |
| Sequence |
MPGMRLVCRLAHGHFPRKGQRRRSLTVWKAETSRADCLGAPNIRTAPLGRSEKRTAICFS |
| Sequence length | 128 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with MIR7-3HG across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to MIR7-3HG (see Related Genes above), that are NOT already directly curated for MIR7-3HG itself -- a lead worth checking, not a confirmed association.
0
|
|