MIR1-1HG (MIR1-1 host gene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 128826 |
| Gene name | MIR1-1 host gene |
| Gene symbol | MIR1-1HG |
| Synonyms (NCBI Gene) |
C20orf166MIR133A2HG
|
| Chromosome | 20 |
| Chromosome location | 20q13.33 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9H1L0 |
| Protein name | Uncharacterized protein MIR1-1HG (MIR1-1 host gene protein) |
| Family and domains | |
| Sequence |
MPSCSCALMAPCGPAAGPAAVERTQQVARGEPGSARGQLQVSPEMSITHKEKENAHLKEI |
| Sequence length | 117 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with MIR1-1HG across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to MIR1-1HG (see Related Genes above), that are NOT already directly curated for MIR1-1HG itself -- a lead worth checking, not a confirmed association.
0
|
|