MIF4GD (MIF4G domain containing)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57409
• Gene name: MIF4G domain containing
• Gene symbol: MIF4GD
• Synonyms (NCBI Gene): AD023, MIFD, SLIP1
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: This gene encodes a protein which interacts with the N-terminus of the stem-loop binding protein (SLBP) and the 3` end of histone mRNA. This interaction facilitates the activation of histone mRNA translation. Alternative splicing results in multiple trans

miRNA Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025776	hsa-miR-7-5p	Microarray	19073608
MIRT1149101	hsa-miR-103a	CLIP-seq
MIRT1149102	hsa-miR-107	CLIP-seq
MIRT1149103	hsa-miR-1179	CLIP-seq
MIRT1149104	hsa-miR-1202	CLIP-seq
MIRT1149105	hsa-miR-1226	CLIP-seq
MIRT1149106	hsa-miR-1229	CLIP-seq
MIRT1149107	hsa-miR-1273f	CLIP-seq
MIRT1149108	hsa-miR-1303	CLIP-seq
MIRT1149109	hsa-miR-138	CLIP-seq
MIRT1149110	hsa-miR-1825	CLIP-seq
MIRT1149111	hsa-miR-3064-5p	CLIP-seq
MIRT1149112	hsa-miR-3132	CLIP-seq
MIRT1149113	hsa-miR-3153	CLIP-seq
MIRT1149114	hsa-miR-3154	CLIP-seq
MIRT1149115	hsa-miR-3194-5p	CLIP-seq
MIRT1149116	hsa-miR-3915	CLIP-seq
MIRT1149117	hsa-miR-3928	CLIP-seq
MIRT1149118	hsa-miR-3944-5p	CLIP-seq
MIRT1149119	hsa-miR-3972	CLIP-seq
MIRT1149120	hsa-miR-4261	CLIP-seq
MIRT1149121	hsa-miR-4276	CLIP-seq
MIRT1149122	hsa-miR-4299	CLIP-seq
MIRT1149123	hsa-miR-4310	CLIP-seq
MIRT1149124	hsa-miR-4650-3p	CLIP-seq
MIRT1149125	hsa-miR-4668-5p	CLIP-seq
MIRT1149126	hsa-miR-4710	CLIP-seq
MIRT1149127	hsa-miR-4733-3p	CLIP-seq
MIRT1149128	hsa-miR-4738-3p	CLIP-seq
MIRT1149129	hsa-miR-4753-5p	CLIP-seq
MIRT1149130	hsa-miR-4768-3p	CLIP-seq
MIRT1149131	hsa-miR-4792	CLIP-seq
MIRT1149132	hsa-miR-494	CLIP-seq
MIRT1149133	hsa-miR-512-3p	CLIP-seq
MIRT1149134	hsa-miR-665	CLIP-seq
MIRT1149135	hsa-miR-671-5p	CLIP-seq
MIRT1149136	hsa-miR-7	CLIP-seq
MIRT1149137	hsa-miR-877	CLIP-seq
MIRT1149138	hsa-miR-888	CLIP-seq
MIRT1149139	hsa-miR-892b	CLIP-seq
MIRT1149140	hsa-miR-134	CLIP-seq
MIRT1149141	hsa-miR-3118	CLIP-seq
MIRT1149142	hsa-miR-3164	CLIP-seq
MIRT1149143	hsa-miR-3650	CLIP-seq
MIRT1149122	hsa-miR-4299	CLIP-seq
MIRT1149144	hsa-miR-4456	CLIP-seq
MIRT1149145	hsa-miR-548q	CLIP-seq
MIRT1149146	hsa-miR-2355-3p	CLIP-seq
MIRT1149147	hsa-miR-3180-5p	CLIP-seq
MIRT1149148	hsa-miR-520a-5p	CLIP-seq
MIRT1149149	hsa-miR-525-5p	CLIP-seq
MIRT1149150	hsa-miR-676	CLIP-seq
MIRT1149146	hsa-miR-2355-3p	CLIP-seq
MIRT2685024	hsa-miR-300	CLIP-seq
MIRT1149111	hsa-miR-3064-5p	CLIP-seq
MIRT2685025	hsa-miR-3135b	CLIP-seq
MIRT2685026	hsa-miR-3163	CLIP-seq
MIRT1149147	hsa-miR-3180-5p	CLIP-seq
MIRT2685027	hsa-miR-3652	CLIP-seq
MIRT2685028	hsa-miR-381	CLIP-seq
MIRT2685029	hsa-miR-4430	CLIP-seq
MIRT2685030	hsa-miR-4505	CLIP-seq
MIRT2685031	hsa-miR-4666-3p	CLIP-seq
MIRT2685032	hsa-miR-4698	CLIP-seq
MIRT1149128	hsa-miR-4738-3p	CLIP-seq
MIRT2685033	hsa-miR-4789-5p	CLIP-seq
MIRT1149148	hsa-miR-520a-5p	CLIP-seq
MIRT1149149	hsa-miR-525-5p	CLIP-seq
MIRT2685034	hsa-miR-568	CLIP-seq
MIRT1149150	hsa-miR-676	CLIP-seq
MIRT2685035	hsa-miR-765	CLIP-seq
MIRT1149139	hsa-miR-892b	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002191	Process	Cap-dependent translational initiation	IDA	18025107
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 17577209, 21988832, 22046132, 23286197, 23804756, 25416956, 25910212, 26871637, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	23286197
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006417	Process	Regulation of translation	IEA
GO:0006446	Process	Regulation of translational initiation	IBA
GO:0008494	Function	Translation activator activity	IBA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	23286197, 23804756
GO:0045727	Process	Positive regulation of translation	IEA
GO:0062073	Component	Histone mRNA stem-loop binding complex	IEA
GO:0062073	Component	Histone mRNA stem-loop binding complex	IPI	23286197

Other IDs

• MIM: 612072
• HGNC: 24030
• e!Ensembl: ENSG00000125457

Protein

• UniProt ID: A9UHW6
• Protein name: MIF4G domain-containing protein (SLBP-interacting protein 1) (hSLIP1)
• Protein function: Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their transl
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02854	MIF4G	3 → 204	MIF4G domain	Family

• Sequence:

  MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCY
  AIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNM
  PMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDG
  FLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

• Sequence length: 222

Related Genes

No strongly related genes found yet for MIF4GD.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MIF4GD.