Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4242
Gene name	MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Gene symbol	MFNG
Synonyms (NCBI Gene)	-
Chromosome	22
Chromosome location	22q13.1
Summary	This gene is a member of the glycosyltransferase 31 gene family. Members of this gene family, which also includes the LFNG (GeneID: 3955) and RFNG (GeneID: 5986) genes, encode evolutionarily conserved glycosyltransferases that act in the Notch signaling p

12 Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018410	hsa-miR-335-5p	Microarray	18185580
MIRT1146318	hsa-miR-205	CLIP-seq
MIRT1146319	hsa-miR-3124-3p	CLIP-seq
MIRT1146320	hsa-miR-431	CLIP-seq
MIRT1556689	hsa-miR-3612	CLIP-seq
MIRT1556690	hsa-miR-650	CLIP-seq
MIRT2271198	hsa-miR-4308	CLIP-seq
MIRT2271199	hsa-miR-4320	CLIP-seq
MIRT2271200	hsa-miR-4725-5p	CLIP-seq
MIRT2271201	hsa-miR-4727-5p	CLIP-seq
MIRT2271202	hsa-miR-4769-3p	CLIP-seq
MIRT2271203	hsa-miR-504	CLIP-seq

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001825	Process	Blastocyst formation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	ISS
GO:0005615	Component	Extracellular space	TAS	9187150
GO:0005794	Component	Golgi apparatus	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0007389	Process	Pattern specification process	TAS	9207795
GO:0008593	Process	Regulation of Notch signaling pathway	IBA
GO:0008593	Process	Regulation of Notch signaling pathway	IEA
GO:0008593	Process	Regulation of Notch signaling pathway	ISS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0033829	Function	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IBA
GO:0033829	Function	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IDA	10935626
GO:0033829	Function	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602577	7038	ENSG00000100060

O00587

Protein name

Beta-1,3-N-acetylglucosaminyltransferase manic fringe (EC 2.4.1.222) (O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase)

Protein function

Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules (By similarity). Modulates NOTCH1 activity by modifying O-fucose residues at specific EGF-l

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02434	Fringe	49 → 300	Fringe-like	Family

Sequence

MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAV
KTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALS
CKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASE
PQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIE
CKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FRSLHCLLYPDTPWCPQLGAR

Sequence length

321

Interactions

View interactions

KEGG Pathway
Other types of O-glycan biosynthesis
Notch signaling pathway
Human papillomavirus infection

MFNG (MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase)

Bookmark This Gene