METTL18 (methyltransferase 18, RPL3 N3(tau)-histidine)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 92342
• Gene name: Methyltransferase 18, RPL3 N3(tau)-histidine
• Gene symbol: METTL18
• Synonyms (NCBI Gene): AsTP2, C1orf156, HPM1
• Chromosome: 1
• Chromosome location: 1q24.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037916	hsa-miR-532-3p	CLASH	23622248

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IC	23636399
GO:0005515	Function	Protein binding	IPI	23349634
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	33693809
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA	33693809
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	33693809
GO:0005829	Component	Cytosol	IEA
GO:0006417	Process	Regulation of translation	IBA
GO:0006417	Process	Regulation of translation	IMP	33693809
GO:0006448	Process	Regulation of translational elongation	IDA	35674491
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018026	Process	Peptidyl-lysine monomethylation	IDA	33693809
GO:0018064	Function	Protein-L-histidine N-tele-methyltransferase activity	IBA
GO:0018064	Function	Protein-L-histidine N-tele-methyltransferase activity	IDA	33693809, 35674491
GO:0018064	Function	Protein-L-histidine N-tele-methyltransferase activity	IEA
GO:0031072	Function	Heat shock protein binding	IPI	23349634
GO:0032259	Process	Methylation	IEA
GO:0032991	Component	Protein-containing complex	IDA	23349634
GO:0032991	Component	Protein-containing complex	IEA
GO:0090069	Process	Regulation of ribosome biogenesis	IMP	33693809
GO:2000232	Process	Regulation of rRNA processing	IMP	33693809

Other IDs

• MIM: 615255
• HGNC: 28793
• e!Ensembl: ENSG00000171806

Protein

• UniProt ID: O95568
• Protein name: Histidine protein methyltransferase 1 homolog (EC 2.1.1.85) (Arsenic-transactivated protein 2) (AsTP2) (Methyltransferase-like protein 18)
• Protein function: Protein-L-histidine N-tele-methyltransferase that specifically monomethylates RPL3, thereby regulating translation elongation (PubMed:23349634, PubMed:33693809, PubMed:35674491). Histidine methylation of RPL3 regulates translation elongation by
• PDB: 4RFQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13489	Methyltransf_23	171 → 338		Domain

• Sequence:

  MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHL
  WEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIET
  LPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFT
  KAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDE
  ENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPD
  YYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLK
  RFIIEITFKFPG

• Sequence length: 372

Related Genes

No strongly related genes found yet for METTL18.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to METTL18.