METTL17 (methyltransferase like 17)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 64745
• Gene name: Methyltransferase like 17
• Gene symbol: METTL17
• Synonyms (NCBI Gene): METT11D1
• Chromosome: 14
• Chromosome location: 14q11.2

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044671	hsa-miR-320a	CLASH	23622248
MIRT040926	hsa-miR-18a-3p	CLASH	23622248
MIRT2270663	hsa-miR-3690	CLIP-seq
MIRT2270664	hsa-miR-4254	CLIP-seq
MIRT2270665	hsa-miR-4514	CLIP-seq
MIRT2270666	hsa-miR-4645-5p	CLIP-seq
MIRT2270667	hsa-miR-4667-3p	CLIP-seq
MIRT2270668	hsa-miR-4673	CLIP-seq
MIRT2270669	hsa-miR-4692	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 21516116, 25416956, 26871637, 29892012, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	ISS
GO:0006412	Process	Translation	IEA
GO:0008168	Function	Methyltransferase activity	IDA	38234605
GO:0036094	Function	Small molecule binding	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IDA	36482135, 38199006
GO:0051539	Function	4 iron, 4 sulfur cluster binding	IEA
GO:0070013	Component	Intracellular organelle lumen	IEA
GO:0097177	Function	Mitochondrial ribosome binding	IEA
GO:0180026	Process	Mitochondrial small ribosomal subunit assembly	IDA	36482135, 38199006
GO:1904047	Function	S-adenosyl-L-methionine binding	IEA
GO:1904047	Function	S-adenosyl-L-methionine binding	ISS

Other IDs

• MIM: 616091
• HGNC: 19280
• e!Ensembl: ENSG00000165792

Protein

• UniProt ID: Q9H7H0
• Protein name: Ribosome assembly protein METTL17, mitochondrial (False p73 target gene protein) (Methyltransferase 11 domain-containing protein 1) (Methyltransferase-like protein 17) (Protein RSM22 homolog, mitochondrial)
• Protein function: Mitochondrial ribosome (mitoribosome) assembly factor (PubMed:36482135, PubMed:38199006). Binds at the interface of the head and body domains of the mitochondrial small ribosomal subunit (mt-SSU), occluding the mRNA channel and preventing compac
• PDB: 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09243	Rsm22	153 → 438	Mitochondrial small ribosomal subunit Rsm22	Family

• Sequence:

  MAAALKCLLTLGRWCPGLGVAPQARALAALVPGVTQVDNKSGFLQKRPHRQHPGILKLPH
  VRLPQALANGAQLLLLGSAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLEN
  PDLSQTEEKLRGAVLHALRKTTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRAR
  NPAFQPQTLMDFGSGTGSVTWAAHSIWGQSLREYMCVDRSAAMLVLAEKLLKGGSESGEP
  YIPGVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLVLVENGTK
  AGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSW
  NKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRH
  GRDLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES

• Sequence length: 456

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	26488768	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26488768	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	24137763		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for METTL17.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to METTL17.