METTL15P1 (methyltransferase like 15 pseudogene 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100130758
Gene name Methyltransferase like 15 pseudogene 1
Gene symbol METTL15P1
Synonyms (NCBI Gene)
METT5D2
Chromosome 3
Chromosome location 3q25.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0008168 Function Methyltransferase activity IEA
GO:0016740 Function Transferase activity IEA
GO:0032259 Process Methylation IEA
GO:0070475 Process RRNA base methylation IBA
GO:0071424 Function RRNA (cytosine-N4-)-methyltransferase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31926 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C7V9
Protein name Putative methyltransferase-like protein 15P1 (EC 2.1.1.-) (Methyltransferase 5 domain-containing protein 2) (Methyltransferase-like protein 15 pseudogene 1)
Protein function Probable S-adenosyl-L-methionine-dependent methyltransferase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01795 Methyltransf_5 69 → 226 MraW methylase family Family
Sequence 
MLRYPYFCRMYKECLSCWLESGIPNLGVWPKRIHTTAEKYREYEAREQTDQTQVQELHRS
QDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDR
DPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTP
ERGSSLRKDGPLDIRMDGGRNISSLCYLYTERLTTAIYLYCHQDFPGSSHICEQ
Sequence length 234
Interactions View interactions

No strongly related genes found yet for METTL15P1.

No additional diseases found yet through genes similar to METTL15P1.