MEPCE (methylphosphate capping enzyme)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 56257
• Gene name: Methylphosphate capping enzyme
• Gene symbol: MEPCE
• Synonyms (NCBI Gene): BCDIN3
• Chromosome: 7
• Chromosome location: 7q22.1

miRNA Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025825	hsa-miR-7-5p	Microarray	19073608
MIRT031627	hsa-miR-16-5p	Proteomics	18668040
MIRT052367	hsa-let-7a-5p	CLASH	23622248
MIRT052367	hsa-let-7a-5p	CLASH	23622248
MIRT047259	hsa-miR-181b-5p	CLASH	23622248
MIRT046065	hsa-miR-125b-5p	CLASH	23622248
MIRT042658	hsa-miR-196b-5p	CLASH	23622248
MIRT041225	hsa-miR-193b-3p	CLASH	23622248
MIRT041225	hsa-miR-193b-3p	CLASH	23622248
MIRT039292	hsa-miR-671-5p	CLASH	23622248
MIRT1143010	hsa-miR-101	CLIP-seq
MIRT1143011	hsa-miR-1236	CLIP-seq
MIRT1143012	hsa-miR-1238	CLIP-seq
MIRT1143013	hsa-miR-128	CLIP-seq
MIRT1143014	hsa-miR-1290	CLIP-seq
MIRT1143015	hsa-miR-1301	CLIP-seq
MIRT1143016	hsa-miR-1302	CLIP-seq
MIRT1143017	hsa-miR-1321	CLIP-seq
MIRT1143018	hsa-miR-151-5p	CLIP-seq
MIRT1143019	hsa-miR-1827	CLIP-seq
MIRT1143020	hsa-miR-203	CLIP-seq
MIRT1143021	hsa-miR-27a	CLIP-seq
MIRT1143022	hsa-miR-27b	CLIP-seq
MIRT1143023	hsa-miR-2909	CLIP-seq
MIRT1143024	hsa-miR-3124-3p	CLIP-seq
MIRT1143025	hsa-miR-3162-5p	CLIP-seq
MIRT1143026	hsa-miR-335	CLIP-seq
MIRT1143027	hsa-miR-361-3p	CLIP-seq
MIRT1143028	hsa-miR-3616-3p	CLIP-seq
MIRT1143029	hsa-miR-3665	CLIP-seq
MIRT1143030	hsa-miR-3679-3p	CLIP-seq
MIRT1143031	hsa-miR-377	CLIP-seq
MIRT1143032	hsa-miR-3929	CLIP-seq
MIRT1143033	hsa-miR-412	CLIP-seq
MIRT1143034	hsa-miR-4278	CLIP-seq
MIRT1143035	hsa-miR-4298	CLIP-seq
MIRT1143036	hsa-miR-4419b	CLIP-seq
MIRT1143037	hsa-miR-4436b-3p	CLIP-seq
MIRT1143038	hsa-miR-4468	CLIP-seq
MIRT1143039	hsa-miR-4478	CLIP-seq
MIRT1143040	hsa-miR-4533	CLIP-seq
MIRT1143041	hsa-miR-4649-3p	CLIP-seq
MIRT1143042	hsa-miR-4652-3p	CLIP-seq
MIRT1143043	hsa-miR-4660	CLIP-seq
MIRT1143044	hsa-miR-4695-5p	CLIP-seq
MIRT1143045	hsa-miR-4716-3p	CLIP-seq
MIRT1143046	hsa-miR-4726-3p	CLIP-seq
MIRT1143047	hsa-miR-4739	CLIP-seq
MIRT1143048	hsa-miR-4747-5p	CLIP-seq
MIRT1143049	hsa-miR-4756-5p	CLIP-seq
MIRT1143050	hsa-miR-485-5p	CLIP-seq
MIRT1143051	hsa-miR-503	CLIP-seq
MIRT1143052	hsa-miR-5047	CLIP-seq
MIRT1143053	hsa-miR-5096	CLIP-seq
MIRT1143054	hsa-miR-513a-5p	CLIP-seq
MIRT1143055	hsa-miR-539	CLIP-seq
MIRT1143056	hsa-miR-556-5p	CLIP-seq
MIRT1143057	hsa-miR-764	CLIP-seq
MIRT1143058	hsa-miR-765	CLIP-seq
MIRT1143059	hsa-miR-1289	CLIP-seq
MIRT1143015	hsa-miR-1301	CLIP-seq
MIRT1143018	hsa-miR-151-5p	CLIP-seq
MIRT1143020	hsa-miR-203	CLIP-seq
MIRT1143060	hsa-miR-3198	CLIP-seq
MIRT1143026	hsa-miR-335	CLIP-seq
MIRT1143061	hsa-miR-4294	CLIP-seq
MIRT1143062	hsa-miR-4309	CLIP-seq
MIRT1143063	hsa-miR-4496	CLIP-seq
MIRT1143043	hsa-miR-4660	CLIP-seq
MIRT1143052	hsa-miR-5047	CLIP-seq
MIRT1143055	hsa-miR-539	CLIP-seq
MIRT2040694	hsa-miR-455-3p	CLIP-seq
MIRT2040694	hsa-miR-455-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001510	Process	RNA methylation	IDA	17643375, 19906723, 24360279, 28431135, 30559425
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IPI	30559425
GO:0005515	Function	Protein binding	IPI	30824372
GO:0005634	Component	Nucleus	IDA	19906723, 28254838
GO:0005634	Component	Nucleus	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008171	Function	O-methyltransferase activity	IBA
GO:0008173	Function	RNA methyltransferase activity	IBA
GO:0008173	Function	RNA methyltransferase activity	IDA	17643375
GO:0008173	Function	RNA methyltransferase activity	IMP	24360279
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	IDA	17643375
GO:0016073	Process	SnRNA metabolic process	IDA	17643375, 19906723, 30559425
GO:0016740	Function	Transferase activity	IEA
GO:0017069	Function	SnRNA binding	IBA
GO:0032259	Process	Methylation	IEA
GO:0040031	Process	SnRNA modification	IBA
GO:0040031	Process	SnRNA modification	IDA	17643375, 19906723, 24360279, 30559425
GO:0097322	Function	7SK snRNA binding	IDA	28431135
GO:0120259	Component	7SK snRNP	IDA	17643375, 28431135
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IEA
GO:1904871	Process	Positive regulation of protein localization to Cajal body	IDA	28254838
GO:1905382	Process	Positive regulation of snRNA transcription by RNA polymerase II	IDA	28254838
GO:1990276	Function	RNA 5'-gamma-phosphate methyltransferase activity	IDA	19906723, 28431135, 30559425
GO:1990904	Component	Ribonucleoprotein complex	IDA	19906723

Other IDs

• MIM: 611478
• HGNC: 20247
• e!Ensembl: ENSG00000146834

Protein

• UniProt ID: Q7L2J0
• Protein name: 7SK snRNA methylphosphate capping enzyme (MePCE) (EC 2.1.1.-) (Bicoid-interacting protein 3 homolog) (Bin3 homolog)
• Protein function: S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA (7SK RNA), leading to stabilize it (PubMed:17643375, PubMed:19906723, PubMed:30559425). Also has a non-enzymatic function as part of t
• PDB: 5UNA , 6DCB , 6DCC , 7SLP , 7SLQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06859	Bin3	575 → 683	Bicoid-interacting protein 3 (Bin3)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in chronic myeloid leukemia cells, adrenal gland, brain, cerebellum, kidney, lung, mammary gland and testis (PubMed:12358911). Weakly or not expressed in other tissues (PubMed:12358911). {ECO:0000269|PubMed:12358911}.
• Sequence:

  MIEMAAEKEPFLVPAPPPPLKDESGGGGGPTVPPHQEAASGELRGGTERGPGRCAPSAGS
  PAAAVGRESPGAAATSSSGPQAQQHRGGGPQAQSHGEARLSDPPGRAAPPDVGEERRGGG
  GTELGPPAPPRPRNGYQPHRPPGGGGGKRRNSCNVGGGGGGFKHPAFKRRRRVNSDCDSV
  LPSNFLLGGNIFDPLNLNSLLDEEVSRTLNAETPKSSPLPAKGRDPVEILIPKDITDPLS
  LNTCTDEGHVVLASPLKTGRKRHRHRGQHHQQQQAAGGSESHPVPPTAPLTPLLHGEGAS
  QQPRHRGQNRDAPQPYELNTAINCRDEVVSPLPSALQGPSGSLSAPPAASVISAPPSSSS
  RHRKRRRTSSKSEAGARGGGQGSKEKGRGSWGGRHHHHHPLPAAGFKKQQRKFQYGNYCK
  YYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLI
  HSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVP
  LDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMF
  RRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSS
  YELVATPHNTSKGFQRPVYLFHKARSPSH

• Sequence length: 689

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Neurodevelopmental delay	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aphasia	Aphasia	Pubtator	31467394	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	31467394	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	31467394		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33416148	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28592245	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31467394		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23950976	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	31467394	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for MEPCE.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MEPCE.