MEP1B (meprin A subunit beta)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4225
• Gene name: Meprin A subunit beta
• Gene symbol: MEP1B
• Synonyms (NCBI Gene): -
• Chromosome: 18
• Chromosome location: 18q12.1
• Summary: Meprins are multidomain zinc metalloproteases that are highly expressed in mammalian kidney and intestinal brush border membranes, and in leukocytes and certain cancer cells. They are involved in the hydrolysis of a variety of peptide and protein substrat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019267	hsa-miR-148b-3p	Microarray	17612493

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	9288916, 23123160, 27180358
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	IDA	9288916
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017090	Component	Meprin A complex	IDA	9288916
GO:0017090	Component	Meprin A complex	IEA
GO:0042802	Function	Identical protein binding	IPI	22988105, 27180358
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 600389
• HGNC: 7020
• e!Ensembl: ENSG00000141434

Protein

• UniProt ID: Q16820
• Protein name: Meprin A subunit beta (EC 3.4.24.63) (Endopeptidase-2) (Meprin B) (N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit beta) (PABA peptide hydrolase) (PPH beta)
• Protein function: Membrane metallopeptidase that sheds many membrane-bound proteins. Exhibits a strong preference for acidic amino acids at the P1' position. Known substrates include: FGF19, VGFA, IL1B, IL18, procollagen I and III, E-cadherin, KLK7, gastrin, ADAM
• PDB: 4GWM , 4GWN , 7AQ1 , 7AUW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00629	MAM	265 → 428	MAM domain, meprin/A5/mu	Domain
  PF01400	Astacin	69 → 257	Astacin (Peptidase family M12A)	Domain

• Tissue specificity: TISSUE SPECIFICITY: The major site of expression is the brush border membrane of small intestinal and kidney epithelial cells. {ECO:0000269|PubMed:12387727}.
• Sequence:

  MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
  RNSIIGEKYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFK
  GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
  LSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
  FSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPESDHS
  NMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIR
  EYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI
  NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLI
  SGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVG
  TVALFSNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTP
  APSVQDLCSKTTCKNDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSST
  VAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHAF

• Sequence length: 701

Pathways

KEGG Pathway:

Protein digestion and absorption

Related Genes

No strongly related genes found yet for MEP1B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MEP1B.