MEIS3 (Meis homeobox 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 56917
• Gene name: Meis homeobox 3
• Gene symbol: MEIS3
• Synonyms (NCBI Gene): MRG2
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells. [provided by RefSeq, Sep

miRNA Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016926	hsa-miR-335-5p	Microarray	18185580
MIRT038310	hsa-miR-130b-5p	CLASH	23622248
MIRT2040662	hsa-miR-127-3p	CLIP-seq
MIRT2040663	hsa-miR-193a-5p	CLIP-seq
MIRT2040664	hsa-miR-3144-5p	CLIP-seq
MIRT2040665	hsa-miR-3182	CLIP-seq
MIRT2040666	hsa-miR-3191	CLIP-seq
MIRT2040667	hsa-miR-4314	CLIP-seq
MIRT2040668	hsa-miR-4316	CLIP-seq
MIRT2040669	hsa-miR-4505	CLIP-seq
MIRT2040670	hsa-miR-4652-5p	CLIP-seq
MIRT2040671	hsa-miR-4667-5p	CLIP-seq
MIRT2040672	hsa-miR-4700-5p	CLIP-seq
MIRT2040673	hsa-miR-637	CLIP-seq
MIRT2270384	hsa-miR-3922-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001525	Process	Angiogenesis	IBA
GO:0001654	Process	Eye development	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007420	Process	Brain development	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009880	Process	Embryonic pattern specification	IBA
GO:0009887	Process	Animal organ morphogenesis	IBA
GO:0030097	Process	Hemopoiesis	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	17178831
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 619443
• HGNC: 29537
• e!Ensembl: ENSG00000105419

Protein

• UniProt ID: Q99687
• Protein name: Homeobox protein Meis3 (Meis1-related protein 2)
• Protein function: Transcriptional regulator which directly modulates PDPK1 expression, thus promoting survival of pancreatic beta-cells. Also regulates expression of NDFIP1, BNIP3, and CCNG1.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05920	Homeobox_KN	280 → 319	Homeobox KN domain	Family
  PF16493	Meis_PKNOX_N	96 → 180	N-terminal of Homeobox Meis and PKNOX1	Family

• Sequence:

  MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEI
  YGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSER
  PLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDG
  GCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGL
  DTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQ
  DTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPG
  SVGMSLNLEGEWHYL

• Sequence length: 375

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Abnormality of neuronal migration	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Glioblastoma	Glioblastoma	Pubtator	38563293	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35180817	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	33539429	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38563293	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for MEIS3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MEIS3.