MEIG1 (meiosis/spermiogenesis associated 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 644890
Gene name Meiosis/spermiogenesis associated 1
Gene symbol MEIG1
Synonyms (NCBI Gene)
SPATA39bA2K17.3
Chromosome 10
Chromosome location 10p13
miRNA miRNA information provided by mirtarbase database.
9 Show/Hide all (9)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2040639 hsa-miR-135a CLIP-seq
MIRT2040640 hsa-miR-135b CLIP-seq
MIRT2040641 hsa-miR-2113 CLIP-seq
MIRT2040642 hsa-miR-3119 CLIP-seq
MIRT2040643 hsa-miR-3140-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002177 Component Manchette IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005829 Component Cytosol IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614174 23429 ENSG00000197889
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5JSS6
Protein name Meiosis expressed gene 1 protein homolog
Protein function Essential for spermiogenesis.
PDB 6NDU , 6NEP , 6UCC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15163 Meiosis_expr 11 → 86 Meiosis-expressed Family
Sequence 
MASSDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQ
RRDNTFYYYNKQRECDDKEVHKVKIYAY
Sequence length 88
Interactions View interactions

No strongly related genes found yet for MEIG1.

No additional diseases found yet through genes similar to MEIG1.