Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4188
Gene name	MyoD family inhibitor
Gene symbol	MDFI
Synonyms (NCBI Gene)	I-MFI-mfa
Chromosome	6
Chromosome location	6p21.1
Summary	This protein is a transcription factor that negatively regulates other myogenic family proteins. Studies of the mouse homolog, I-mf, show that it interferes with myogenic factor function by masking nuclear localization signals and preventing DNA binding.

80 Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018708	hsa-miR-335-5p	Microarray	18185580
MIRT656373	hsa-miR-1470	HITS-CLIP	19536157
MIRT656372	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT656371	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT656370	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT656369	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT656368	hsa-miR-4469	HITS-CLIP	19536157
MIRT656367	hsa-miR-4287	HITS-CLIP	19536157
MIRT656366	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT656364	hsa-miR-623	HITS-CLIP	19536157
MIRT656363	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT656362	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT656360	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT656359	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT656376	hsa-miR-4773	HITS-CLIP	23824327
MIRT656375	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT656374	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT656373	hsa-miR-1470	HITS-CLIP	23824327
MIRT656372	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT656371	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT656370	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT656369	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT656368	hsa-miR-4469	HITS-CLIP	23824327
MIRT656367	hsa-miR-4287	HITS-CLIP	23824327
MIRT656366	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT656365	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT656364	hsa-miR-623	HITS-CLIP	23824327
MIRT656363	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT656362	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT656361	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT656360	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT656359	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT656373	hsa-miR-1470	HITS-CLIP	19536157
MIRT656372	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT656371	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT656370	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT656369	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT656368	hsa-miR-4469	HITS-CLIP	19536157
MIRT656367	hsa-miR-4287	HITS-CLIP	19536157
MIRT656366	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT656364	hsa-miR-623	HITS-CLIP	19536157
MIRT656363	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT656362	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT656360	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT656359	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT656376	hsa-miR-4773	HITS-CLIP	23824327
MIRT656375	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT656374	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT656373	hsa-miR-1470	HITS-CLIP	23824327
MIRT656372	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT656371	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT656370	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT656369	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT656368	hsa-miR-4469	HITS-CLIP	23824327
MIRT656367	hsa-miR-4287	HITS-CLIP	23824327
MIRT656366	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT656365	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT656364	hsa-miR-623	HITS-CLIP	23824327
MIRT656363	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT656362	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT656361	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT656360	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT656359	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT1138454	hsa-miR-128	CLIP-seq
MIRT1138455	hsa-miR-2355-5p	CLIP-seq
MIRT1138456	hsa-miR-27a	CLIP-seq
MIRT1138457	hsa-miR-27b	CLIP-seq
MIRT1138458	hsa-miR-3064-5p	CLIP-seq
MIRT1138459	hsa-miR-4255	CLIP-seq
MIRT1138460	hsa-miR-513a-5p	CLIP-seq
MIRT2039268	hsa-miR-145	CLIP-seq
MIRT2039269	hsa-miR-4269	CLIP-seq
MIRT2039270	hsa-miR-4313	CLIP-seq
MIRT2039271	hsa-miR-452	CLIP-seq
MIRT2039272	hsa-miR-4676-3p	CLIP-seq
MIRT2039273	hsa-miR-4733-3p	CLIP-seq
MIRT2039274	hsa-miR-587	CLIP-seq
MIRT2039275	hsa-miR-665	CLIP-seq
MIRT2039276	hsa-miR-940	CLIP-seq
MIRT2269345	hsa-miR-2861	CLIP-seq

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 17289077, 19060904, 19447967, 21516116, 21653829, 23088713, 24722188, 25416956, 25910212, 26871637, 27107012, 29892012, 30886144, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8797820
GO:0009950	Process	Dorsal/ventral axis specification	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	ISS
GO:0032507	Process	Maintenance of protein location in cell	IDA	8797820
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 27107012
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0046328	Process	Regulation of JNK cascade	IBA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0140311	Function	Protein sequestering activity	IDA	8797820
GO:0140416	Function	Transcription regulator inhibitor activity	TAS	8797820

MIM	HGNC	e!Ensembl
604971	6967	ENSG00000112559

Q99750

Protein name

MyoD family inhibitor (Myogenic repressor I-mf)

Protein function

Inhibits the transactivation activity of the Myod family of myogenic factors and represses myogenesis (By similarity). Acts by associating with Myod family members and retaining them in the cytoplasm by masking their nuclear localization signals

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15316	MDFI	66 → 246	MyoD family inhibitor	Family

Sequence

MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATP
MPQGNGPGIPQGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGA
LGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLC
NIVLDCATCGSCSSEDSCLCCCCCGSGECADCDLPCDLDCGILDACCESADCLEICMECC
GLCFSS

Sequence length

246

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	21779381	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	25261932	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38632662	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	38632662	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (10)
Asthma	Asthma	BEFREE	29066290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26126114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28782576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32457453, 35114976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	33504899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26469549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29805634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32457453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18535405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35225482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with MDFI across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for MDFI.

Diseases Linked via Similar Genes Diseases curated for genes most similar to MDFI (see Related Genes above), that are NOT already directly curated for MDFI itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to MDFI.

MDFI (MyoD family inhibitor)

Bookmark This Gene