MCEMP1 (mast cell expressed membrane protein 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 199675
Gene name Mast cell expressed membrane protein 1
Gene symbol MCEMP1
Synonyms (NCBI Gene)
C19orf59
Chromosome 19
Chromosome location 19p13.2
Summary This gene encodes a single-pass transmembrane protein. Based on its expression pattern, it is speculated to be involved in regulating mast cell differentiation or immune responses. [provided by RefSeq, Jul 2008]
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
GO:0005886 Component Plasma membrane TAS
GO:0016020 Component Membrane IEA
GO:0035579 Component Specific granule membrane TAS
GO:0042802 Function Identical protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609565 27291 ENSG00000183019
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IX19
Protein name Mast cell-expressed membrane protein 1
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in mast cells. Found primarily in lung. {ECO:0000269|PubMed:15953541}.
Sequence 
MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTS
QVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKR
ELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQK
MPQSSPQ
Sequence length 187
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Neutrophil degranulation

No strongly related genes found yet for MCEMP1.

No additional diseases found yet through genes similar to MCEMP1.