MBOAT4 (membrane bound ghrelin O-acyltransferase MBOAT4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 619373
Gene name Membrane bound ghrelin O-acyltransferase MBOAT4
Gene symbol MBOAT4
Synonyms (NCBI Gene)
FKSG89GOATOACT4
Chromosome 8
Chromosome location 8p12
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1135926 hsa-miR-4475 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17 Show/Hide all (17)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005783 Component Endoplasmic reticulum ISS
GO:0005789 Component Endoplasmic reticulum membrane IBA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005789 Component Endoplasmic reticulum membrane ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611940 32311 ENSG00000177669
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96T53
Protein name Membrane-bound ghrelin O-acyltransferase MBOAT4 (EC 2.3.1.-) (Membrane-bound O-acyltransferase domain-containing protein 4) (O-acyltransferase domain-containing protein 4)
Protein function Catalyzes ghrelin acylation at 'Ser-3' using preferentially octanoyl-CoA, hexanoyl-CoA and decanoyl-CoA as acyl-CoA donors leading to ghrelin activity (PubMed:18443287, PubMed:24045953, PubMed:25562443, PubMed:28134508). In vitro also uses acyl-
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03062 MBOAT 74 → 396 MBOAT, membrane-bound O-acyltransferase family Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in stomach with moderate levels in pancreas and relatively low levels in most other tissues. {ECO:0000269|PubMed:18443287}.
Sequence 
MEWLWLFFLHPISFYQGAAFPFALLFNYLCIMDSFSTRARYLFLLTGGGALAVAAMGSYA
VLVFTPAVCAVALLCSLAPQQVHRWTFCFQMSWQTLCHLGLHYTEYYLHEPPSVRFCITL
SSLMLLTQRVTSLSLDICEGKVKAASGGFRSRSSLSEHVCKALPYFSYLLFFPALLGGSL
CSFQRFQARVQGSSALHPRHSFWALSWRGLQILGLECLNVAVSRVVDAGAGLTDCQQFEC
IYVVWTTAGLFKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS
VFSRKWNQSTARWLRRLVFQHSRAWPLLQTFAFSAWWHGLHPGQVFGFVCWAVMVEADYL
IHSFANEFIRSWPMRLFYRTLTWAHTQLIIAYIMLAVEVRSLSSLWLLCNSYNSVFPMVY
CILLLLLAKRKHKCN
Sequence length 435
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Synthesis, secretion, and deacylation of Ghrelin

No strongly related genes found yet for MBOAT4.

No additional diseases found yet through genes similar to MBOAT4.