MBD3L4 (methyl-CpG binding domain protein 3 like 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 653656
Gene name Methyl-CpG binding domain protein 3 like 4
Gene symbol MBD3L4
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.2
Summary This gene encodes a member of a family of proteins that are related to methyl-CpG-binding proteins but lack the methyl-CpG binding domain. There is no definitive support for transcription of this locus, and the transcript structure is inferred from other
miRNA miRNA information provided by mirtarbase database.
13 Show/Hide all (13)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1135055 hsa-miR-2110 CLIP-seq
MIRT1135056 hsa-miR-3202 CLIP-seq
MIRT1135057 hsa-miR-4271 CLIP-seq
MIRT1135058 hsa-miR-4456 CLIP-seq
MIRT1135059 hsa-miR-4668-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006346 Process DNA methylation-dependent constitutive heterochromatin formation IBA
GO:0008327 Function Methyl-CpG binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NDZ8
Protein name Methyl-CpG-binding domain protein 3-like 4 (MBD3-like protein 4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14048 MBD_C 102 → 193 C-terminal domain of methyl-CpG binding protein 2 and 3 Family
PF16564 MBDa 28 → 98 p55-binding region of Methyl-CpG-binding domain proteins MBD Domain
Sequence 
MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRP
VTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAP
GTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQAR
RVKKARERLAKALQADRLARQAEMLTCR
Sequence length 208
Interactions View interactions

No strongly related genes found yet for MBD3L4.

No additional diseases found yet through genes similar to MBD3L4.