MBD3L3 (methyl-CpG binding domain protein 3 like 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 653657
• Gene name: Methyl-CpG binding domain protein 3 like 3
• Gene symbol: MBD3L3
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19p13.2

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1135042	hsa-miR-2110	CLIP-seq
MIRT1135043	hsa-miR-3202	CLIP-seq
MIRT1135044	hsa-miR-4271	CLIP-seq
MIRT1135045	hsa-miR-4456	CLIP-seq
MIRT1135046	hsa-miR-4668-5p	CLIP-seq
MIRT1135047	hsa-miR-4725-3p	CLIP-seq
MIRT1135048	hsa-miR-4747-5p	CLIP-seq
MIRT1135049	hsa-miR-491-5p	CLIP-seq
MIRT1135050	hsa-miR-541	CLIP-seq
MIRT1135051	hsa-miR-548t	CLIP-seq
MIRT1135052	hsa-miR-582-3p	CLIP-seq
MIRT1135053	hsa-miR-595	CLIP-seq
MIRT1135054	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IBA
GO:0008327	Function	Methyl-CpG binding	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A6NE82
• Protein name: Methyl-CpG-binding domain protein 3-like 3 (MBD3-like protein 3)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14048	MBD_C	102 → 193	C-terminal domain of methyl-CpG binding protein 2 and 3	Family
  PF16564	MBDa	28 → 98	p55-binding region of Methyl-CpG-binding domain proteins MBD	Domain

• Sequence:

  MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRP
  VTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAP
  GTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQAR
  RVKKARERLAKALQADRLARQAEMLTCR

• Sequence length: 208

Related Genes

No strongly related genes found yet for MBD3L3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MBD3L3.