MBD3L1 (methyl-CpG binding domain protein 3 like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 85509
Gene name Methyl-CpG binding domain protein 3 like 1
Gene symbol MBD3L1
Synonyms (NCBI Gene)
MBD3L
Chromosome 19
Chromosome location 19p13.2
Summary This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005515 Function Protein binding IPI 26275350, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006346 Process DNA methylation-dependent constitutive heterochromatin formation IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607963 15774 ENSG00000170948
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WWY6
Protein name Methyl-CpG-binding domain protein 3-like 1 (MBD3-like protein 1)
Protein function Transcriptional repressor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14048 MBD_C 80 → 172 C-terminal domain of methyl-CpG binding protein 2 and 3 Family
PF16564 MBDa 6 → 76 p55-binding region of Methyl-CpG-binding domain proteins MBD Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis. Detected at low levels in pancreas. Not detected in the other tissues tested. {ECO:0000269|PubMed:12504854}.
Sequence 
MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLE
KPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMP
HLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANE
AEKVRDQEGRPEKR
Sequence length 194
Interactions View interactions

No strongly related genes found yet for MBD3L1.

No additional diseases found yet through genes similar to MBD3L1.