Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	116511
Gene name	MAS1 proto-oncogene like, G protein-coupled receptor
Gene symbol	MAS1L
Synonyms (NCBI Gene)	MAS-LMRGdJ994E9.2
Chromosome	6
Chromosome location	6p22.1

miRTarBase ID	miRNA	Experiments	Reference
MIRT025912	hsa-miR-7-5p	Microarray	17612493

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	NAS	1723144
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	1723144
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	1723144

MIM	HGNC	e!Ensembl
607235	13961	ENSG00000204687

P35410

Protein name

Mas-related G-protein coupled receptor MRG (MAS-R) (MAS1-like)

Family and domains

Sequence

MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETI
HMQMSMAVGQQALPLNIIAPKAVLVSLCGVLLNGTVFWLLCCGATNPYMVYILHLVAADV
IYLCCSAVGFLQVTLLTYHGVVFFIPDFLAILSPFSFEVCLCLLVAISTERCVCVLFPIW
YRCHRPKYTSNVVCTLIWGLPFCINIVKSLFLTYWKHVKACVIFLKLSGLFHAILSLVMC
VSSLTLLIRFLCCSQQQKATRVYAVVQISAPMFLLWALPLSVAPLITDFKMFVTTSYLIS
LFLIINSSANPIIYFFVGSLRKKRLKESLRVILQRALADKPEVGRNKKAAGIDPMEQPHS
TQHVENLLPREHRVDVET

Sequence length

378

Interactions

View interactions

Related Genes Genes most often co-reported with MAS1L across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for MAS1L.

Diseases Linked via Similar Genes Diseases curated for genes most similar to MAS1L (see Related Genes above), that are NOT already directly curated for MAS1L itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to MAS1L.

MAS1L (MAS1 proto-oncogene like, G protein-coupled receptor)

Save This Analysis