Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5603
Gene name	Mitogen-activated protein kinase 13
Gene symbol	MAPK13
Synonyms (NCBI Gene)	MAPK 13MAPK-13PRKM13SAPK4p38delta
Chromosome	6
Chromosome location	6p21.31
Summary	This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, tra

137

Show/Hide all (137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT519502	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT519501	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT519499	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT519500	hsa-miR-4761-5p	PAR-CLIP	23446348
MIRT519498	hsa-miR-6814-5p	PAR-CLIP	23446348
MIRT519497	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT519496	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT519495	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT519494	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT462717	hsa-miR-4773	PAR-CLIP	23592263
MIRT462716	hsa-miR-4690-3p	PAR-CLIP	23592263
MIRT462715	hsa-miR-5685	PAR-CLIP	23592263
MIRT462714	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT462713	hsa-miR-4534	PAR-CLIP	23592263
MIRT462711	hsa-miR-8082	PAR-CLIP	23592263
MIRT462712	hsa-miR-3134	PAR-CLIP	23592263
MIRT462710	hsa-miR-4434	PAR-CLIP	23592263
MIRT462709	hsa-miR-4516	PAR-CLIP	23592263
MIRT462708	hsa-miR-5703	PAR-CLIP	23592263
MIRT462707	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT462706	hsa-miR-4525	PAR-CLIP	23592263
MIRT462705	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT462704	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462702	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462703	hsa-miR-4531	PAR-CLIP	23592263
MIRT462701	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT519502	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT519501	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT519499	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT519500	hsa-miR-4761-5p	PAR-CLIP	23446348
MIRT519498	hsa-miR-6814-5p	PAR-CLIP	23446348
MIRT519497	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT519496	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT519495	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT519494	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT462717	hsa-miR-4773	PAR-CLIP	23592263
MIRT462716	hsa-miR-4690-3p	PAR-CLIP	23592263
MIRT462715	hsa-miR-5685	PAR-CLIP	23592263
MIRT462714	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT462713	hsa-miR-4534	PAR-CLIP	23592263
MIRT462711	hsa-miR-8082	PAR-CLIP	23592263
MIRT462712	hsa-miR-3134	PAR-CLIP	23592263
MIRT462710	hsa-miR-4434	PAR-CLIP	23592263
MIRT462709	hsa-miR-4516	PAR-CLIP	23592263
MIRT462708	hsa-miR-5703	PAR-CLIP	23592263
MIRT462707	hsa-miR-5187-5p	PAR-CLIP	23592263
MIRT462706	hsa-miR-4525	PAR-CLIP	23592263
MIRT462705	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT462704	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462702	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462703	hsa-miR-4531	PAR-CLIP	23592263
MIRT462701	hsa-miR-3691-5p	PAR-CLIP	23592263
MIRT1130354	hsa-miR-103a	CLIP-seq
MIRT1130355	hsa-miR-107	CLIP-seq
MIRT1130356	hsa-miR-122	CLIP-seq
MIRT1130357	hsa-miR-1276	CLIP-seq
MIRT1130358	hsa-miR-1288	CLIP-seq
MIRT1130359	hsa-miR-134	CLIP-seq
MIRT1130360	hsa-miR-200b	CLIP-seq
MIRT1130361	hsa-miR-200c	CLIP-seq
MIRT1130362	hsa-miR-2110	CLIP-seq
MIRT1130363	hsa-miR-3118	CLIP-seq
MIRT1130364	hsa-miR-3156-5p	CLIP-seq
MIRT1130365	hsa-miR-3164	CLIP-seq
MIRT1130366	hsa-miR-3189-3p	CLIP-seq
MIRT1130367	hsa-miR-320e	CLIP-seq
MIRT1130368	hsa-miR-34a	CLIP-seq
MIRT1130369	hsa-miR-34c-5p	CLIP-seq
MIRT1130370	hsa-miR-377	CLIP-seq
MIRT1130371	hsa-miR-3942-5p	CLIP-seq
MIRT1130372	hsa-miR-4251	CLIP-seq
MIRT1130373	hsa-miR-4271	CLIP-seq
MIRT1130374	hsa-miR-429	CLIP-seq
MIRT1130375	hsa-miR-4324	CLIP-seq
MIRT1130376	hsa-miR-4446-3p	CLIP-seq
MIRT1130377	hsa-miR-4463	CLIP-seq
MIRT1130378	hsa-miR-4476	CLIP-seq
MIRT1130379	hsa-miR-449a	CLIP-seq
MIRT1130380	hsa-miR-449b	CLIP-seq
MIRT1130381	hsa-miR-4501	CLIP-seq
MIRT1130382	hsa-miR-4504	CLIP-seq
MIRT1130383	hsa-miR-4533	CLIP-seq
MIRT1130384	hsa-miR-4632	CLIP-seq
MIRT1130385	hsa-miR-4656	CLIP-seq
MIRT1130386	hsa-miR-4667-5p	CLIP-seq
MIRT1130387	hsa-miR-4682	CLIP-seq
MIRT1130388	hsa-miR-4700-5p	CLIP-seq
MIRT1130389	hsa-miR-4703-5p	CLIP-seq
MIRT1130390	hsa-miR-4725-3p	CLIP-seq
MIRT1130391	hsa-miR-4765	CLIP-seq
MIRT1130392	hsa-miR-580	CLIP-seq
MIRT1130393	hsa-miR-619	CLIP-seq
MIRT1130394	hsa-miR-635	CLIP-seq
MIRT1130354	hsa-miR-103a	CLIP-seq
MIRT1130355	hsa-miR-107	CLIP-seq
MIRT1130356	hsa-miR-122	CLIP-seq
MIRT2037149	hsa-miR-3154	CLIP-seq
MIRT1130376	hsa-miR-4446-3p	CLIP-seq
MIRT2037150	hsa-miR-4452	CLIP-seq
MIRT1130377	hsa-miR-4463	CLIP-seq
MIRT1130382	hsa-miR-4504	CLIP-seq
MIRT1130385	hsa-miR-4656	CLIP-seq
MIRT1130387	hsa-miR-4682	CLIP-seq
MIRT2037151	hsa-miR-4742-3p	CLIP-seq
MIRT2037152	hsa-miR-4747-3p	CLIP-seq
MIRT1130391	hsa-miR-4765	CLIP-seq
MIRT2037153	hsa-miR-544	CLIP-seq
MIRT2037154	hsa-miR-630	CLIP-seq
MIRT1130364	hsa-miR-3156-5p	CLIP-seq
MIRT2267194	hsa-miR-3159	CLIP-seq
MIRT1130370	hsa-miR-377	CLIP-seq
MIRT1130376	hsa-miR-4446-3p	CLIP-seq
MIRT1130382	hsa-miR-4504	CLIP-seq
MIRT1130385	hsa-miR-4656	CLIP-seq
MIRT1130387	hsa-miR-4682	CLIP-seq
MIRT2267195	hsa-miR-541	CLIP-seq
MIRT2267196	hsa-miR-654-5p	CLIP-seq
MIRT1130354	hsa-miR-103a	CLIP-seq
MIRT1130355	hsa-miR-107	CLIP-seq
MIRT1130356	hsa-miR-122	CLIP-seq
MIRT1130357	hsa-miR-1276	CLIP-seq
MIRT1130358	hsa-miR-1288	CLIP-seq
MIRT2566995	hsa-miR-2355-5p	CLIP-seq
MIRT1130367	hsa-miR-320e	CLIP-seq
MIRT1130371	hsa-miR-3942-5p	CLIP-seq
MIRT2566996	hsa-miR-4320	CLIP-seq
MIRT2037150	hsa-miR-4452	CLIP-seq
MIRT1130378	hsa-miR-4476	CLIP-seq
MIRT1130383	hsa-miR-4533	CLIP-seq
MIRT1130384	hsa-miR-4632	CLIP-seq
MIRT1130389	hsa-miR-4703-5p	CLIP-seq
MIRT2037152	hsa-miR-4747-3p	CLIP-seq
MIRT1130391	hsa-miR-4765	CLIP-seq
MIRT2037153	hsa-miR-544	CLIP-seq
MIRT2037150	hsa-miR-4452	CLIP-seq
MIRT2037152	hsa-miR-4747-3p	CLIP-seq
MIRT2037153	hsa-miR-544	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12244047, 15850461
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004707	Function	MAP kinase activity	IDA	9218798, 9731215
GO:0004707	Function	MAP kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	19135240, 22447027, 28514442, 32852592, 33961781, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006970	Process	Response to osmotic stress	IDA	9731215
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	19279008
GO:0033554	Process	Cellular response to stress	IEA
GO:0034644	Process	Cellular response to UV	IDA	9218798
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	19279008
GO:0051403	Process	Stress-activated MAPK cascade	IDA	9218798
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	9218798
GO:0071347	Process	Cellular response to interleukin-1	IDA	9218798
GO:0072709	Process	Cellular response to sorbitol	IDA	9218798
GO:0072740	Process	Cellular response to anisomycin	IDA	9218798
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903936	Process	Cellular response to sodium arsenite	IDA	9218798

MIM	HGNC	e!Ensembl
602899	6875	ENSG00000156711

O15264

Protein name

Mitogen-activated protein kinase 13 (MAP kinase 13) (MAPK 13) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 delta) (MAP kinase p38 delta) (Stress-activated protein kinase 4)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli su

PDB

3COI , 4EYJ , 4EYM , 4MYG , 4YNO , 5EKN , 5EKO , 8X23

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	25 → 308	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells. {ECO:0000269|PubMed:10201954, ECO:0000269|PubMed:9374491}.

Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL

Sequence length

365

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11145021, 27898717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40650018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	23088660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34267747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19920204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19920204, 33213267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28893210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27992079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19816939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	20626112		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30759005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31695024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31695024, 31881903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28962184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32993645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35899893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23722928	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25099621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	28893210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32102969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28045574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	22836805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19920204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26969274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25535908, 26969274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19920204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24999589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	LHGDN	16644870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28852147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	22836805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26969274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15115313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29049013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29747487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30106143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24336635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27472710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAPK13 (mitogen-activated protein kinase 13)