Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6300
Gene name	Mitogen-activated protein kinase 12
Gene symbol	MAPK12
Synonyms (NCBI Gene)	ERK-6ERK3ERK6MAPK 12P38GAMMAPRKM12SAPK-3SAPK3
Chromosome	22
Chromosome location	22q13.33
Summary	Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments
MIRT1551126	hsa-miR-1203	CLIP-seq
MIRT1551127	hsa-miR-4715-3p	CLIP-seq
MIRT1551128	hsa-miR-4756-3p	CLIP-seq
MIRT1551126	hsa-miR-1203	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT1551127	hsa-miR-4715-3p	CLIP-seq
MIRT1551128	hsa-miR-4756-3p	CLIP-seq
MIRT2267114	hsa-miR-1226	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT2267115	hsa-miR-4267	CLIP-seq
MIRT2267116	hsa-miR-4758-3p	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453712	hsa-miR-125a-3p	CLIP-seq
MIRT2453713	hsa-miR-1266	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453715	hsa-miR-3190	CLIP-seq
MIRT2453716	hsa-miR-3202	CLIP-seq
MIRT2453717	hsa-miR-3664-3p	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453719	hsa-miR-3934	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453723	hsa-miR-4518	CLIP-seq
MIRT2453724	hsa-miR-4533	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453728	hsa-miR-493	CLIP-seq
MIRT2453729	hsa-miR-764	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	15850461
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	10508788
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8633070, 15850461
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	18221368
GO:0004707	Function	MAP kinase activity	IEA
GO:0004707	Function	MAP kinase activity	TAS	10848581
GO:0005515	Function	Protein binding	IPI	12761180, 15158451, 19294699, 24550280, 25158884, 25241761, 25416956, 30126976, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	8633070
GO:0007517	Process	Muscle organ development	TAS	8633070
GO:0016301	Function	Kinase activity	IEA
GO:0016504	Function	Peptidase activator activity	NAS	18221368
GO:0016740	Function	Transferase activity	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042770	Process	Signal transduction in response to DNA damage	TAS	10848581
GO:0045445	Process	Myoblast differentiation	IDA	8633070
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0051726	Process	Regulation of cell cycle	TAS	10848581
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602399	6874	ENSG00000188130

P53778

Protein name

Mitogen-activated protein kinase 12 (MAP kinase 12) (MAPK 12) (EC 2.7.11.24) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK12 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli su

PDB

1CM8 , 4QUM , 6UNA , 7CGA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	27 → 311	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle and heart. {ECO:0000269|PubMed:11991731, ECO:0000269|PubMed:8633070}.

Sequence

MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL

Sequence length

367

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyloidosis	Amyloidosis	BEFREE	29729668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16885352, 18437204, 24993294, 26588708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16885352, 20649952, 21878638, 24993294, 36524361, 38214819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38214819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22505454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12679910	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22505454, 26701725, 29101390, 30166347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39831920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29101390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20332238, 24962213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	30642948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31229268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	30177863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23807566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28079973, 30569573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	16920889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28241849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12679910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28079973, 30569573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16885352, 18437204, 24993294, 26588708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22505454, 26701725, 29101390, 30166347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20332238, 28079973, 29101390, 30166347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29101390		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16964379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22505454, 26242269, 28241849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28810556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30803373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31229268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29747487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38214819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAPK12 (mitogen-activated protein kinase 12)