Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5600
Gene name	Mitogen-activated protein kinase 11
Gene symbol	MAPK11
Synonyms (NCBI Gene)	P38BP38BETA2PRKM11SAPK2SAPK2Bp38-2p38Beta
Chromosome	22
Chromosome location	22q13.33
Summary	This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The

Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003097	hsa-miR-122-5p	Luciferase reporter assayqRT-PCR	19296470
MIRT022536	hsa-miR-124-3p	Microarray	18668037
MIRT052537	hsa-let-7a-5p	CLASH	23622248
MIRT1130063	hsa-miR-1205	CLIP-seq
MIRT1130064	hsa-miR-1302	CLIP-seq
MIRT1130065	hsa-miR-1909	CLIP-seq
MIRT1130066	hsa-miR-298	CLIP-seq
MIRT1130067	hsa-miR-3663-3p	CLIP-seq
MIRT1130068	hsa-miR-3918	CLIP-seq
MIRT1130069	hsa-miR-4298	CLIP-seq
MIRT1130070	hsa-miR-4330	CLIP-seq
MIRT1130071	hsa-miR-4436b-3p	CLIP-seq
MIRT1130072	hsa-miR-4640-5p	CLIP-seq
MIRT1130073	hsa-miR-4726-5p	CLIP-seq
MIRT1130074	hsa-miR-541	CLIP-seq
MIRT1130075	hsa-miR-574-3p	CLIP-seq
MIRT1130076	hsa-miR-602	CLIP-seq
MIRT1130077	hsa-miR-654-5p	CLIP-seq
MIRT2037035	hsa-miR-204	CLIP-seq
MIRT2037036	hsa-miR-211	CLIP-seq
MIRT2037037	hsa-miR-4643	CLIP-seq
MIRT2037038	hsa-miR-627	CLIP-seq
MIRT2267113	hsa-miR-1915	CLIP-seq
MIRT2453706	hsa-miR-296-5p	CLIP-seq
MIRT2453707	hsa-miR-4292	CLIP-seq
MIRT2453708	hsa-miR-4308	CLIP-seq
MIRT2453709	hsa-miR-4749-3p	CLIP-seq
MIRT2453710	hsa-miR-670	CLIP-seq

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	35857590
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IDA	8663524, 10330143
GO:0004707	Function	MAP kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	17254968, 17380123, 21988832, 23602568, 28514442, 32707033, 32814053, 33961781, 35271311, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0010628	Process	Positive regulation of gene expression	IMP	25754930
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	35857590
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	25754930
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0038066	Process	P38MAPK cascade	IDA	10330143
GO:0038066	Process	P38MAPK cascade	TAS
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	23483889
GO:0051149	Process	Positive regulation of muscle cell differentiation	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0051403	Process	Stress-activated MAPK cascade	IDA	8663524, 35857590
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0051604	Process	Protein maturation	IDA	32109412
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	IEA
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IEA
GO:0060348	Process	Bone development	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412
GO:0071347	Process	Cellular response to interleukin-1	IDA	8663524
GO:0071493	Process	Cellular response to UV-B	IDA	35857590
GO:0071493	Process	Cellular response to UV-B	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0098586	Process	Cellular response to virus	IEA
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1904784	Process	NLRP1 inflammasome complex assembly	IDA	22665479

MIM	HGNC	e!Ensembl
602898	6873	ENSG00000185386

Q15759

Protein name

Mitogen-activated protein kinase 11 (MAP kinase 11) (MAPK 11) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 beta) (MAP kinase p38 beta) (p38b) (Stress-activated protein kinase 2b) (SAPK2b) (p38-2)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:12452429, PubMed:20626350, PubMed:35857590). MAPK11 is one of the four p38 MAPKs which play an important role in the cascades of c

PDB

3GC8 , 3GC9 , 3GP0 , 8YGW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	24 → 308	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ

Sequence length

364

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	25066918, 30259868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36744961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	11162833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37525479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10620750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10620750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11448946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12756297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31123170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31123170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21911485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21911485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11162833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29134957, 29151587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26911458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35618095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20053787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15273249	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31822654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22415779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25066918, 30259868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25164947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10620750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11162833, 31123170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37394064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	25148579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29747487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37569854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAPK11 (mitogen-activated protein kinase 11)