MAP6D1 (MAP6 domain containing 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79929
• Gene name: MAP6 domain containing 1
• Gene symbol: MAP6D1
• Synonyms (NCBI Gene): MAPO6D1, SL21
• Chromosome: 3
• Chromosome location: 3q27.1
• Summary: This gene encodes a protein highly similar to the mouse MAP6 domain containing 1 protein, which is related to the STOP proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that bind

miRNA Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024318	hsa-miR-215-5p	Microarray	19074876
MIRT026708	hsa-miR-192-5p	Microarray	19074876
MIRT1129708	hsa-miR-1238	CLIP-seq
MIRT1129709	hsa-miR-125a-3p	CLIP-seq
MIRT1129710	hsa-miR-1299	CLIP-seq
MIRT1129711	hsa-miR-3182	CLIP-seq
MIRT1129712	hsa-miR-3653	CLIP-seq
MIRT1129713	hsa-miR-3658	CLIP-seq
MIRT1129714	hsa-miR-3665	CLIP-seq
MIRT1129715	hsa-miR-3690	CLIP-seq
MIRT1129716	hsa-miR-374a	CLIP-seq
MIRT1129717	hsa-miR-374b	CLIP-seq
MIRT1129718	hsa-miR-4254	CLIP-seq
MIRT1129719	hsa-miR-4659a-3p	CLIP-seq
MIRT1129720	hsa-miR-4659b-3p	CLIP-seq
MIRT1129721	hsa-miR-4691-5p	CLIP-seq
MIRT1129722	hsa-miR-4738-3p	CLIP-seq
MIRT1129723	hsa-miR-4782-5p	CLIP-seq
MIRT1129724	hsa-miR-510	CLIP-seq
MIRT1129725	hsa-miR-512-5p	CLIP-seq
MIRT1129726	hsa-miR-513a-3p	CLIP-seq
MIRT1129727	hsa-miR-516b	CLIP-seq
MIRT1129728	hsa-miR-657	CLIP-seq
MIRT1129729	hsa-miR-875-3p	CLIP-seq
MIRT2036973	hsa-miR-145	CLIP-seq
MIRT2036974	hsa-miR-3184	CLIP-seq
MIRT2036975	hsa-miR-3622b-5p	CLIP-seq
MIRT2036976	hsa-miR-3652	CLIP-seq
MIRT2036977	hsa-miR-423-5p	CLIP-seq
MIRT2036978	hsa-miR-4277	CLIP-seq
MIRT2036979	hsa-miR-4430	CLIP-seq
MIRT2036980	hsa-miR-4675	CLIP-seq
MIRT2036981	hsa-miR-4741	CLIP-seq
MIRT2036982	hsa-miR-634	CLIP-seq
MIRT2036983	hsa-miR-873	CLIP-seq
MIRT2267036	hsa-miR-3125	CLIP-seq
MIRT2267037	hsa-miR-3187-3p	CLIP-seq
MIRT2036976	hsa-miR-3652	CLIP-seq
MIRT2267038	hsa-miR-3916	CLIP-seq
MIRT2036979	hsa-miR-4430	CLIP-seq
MIRT2267039	hsa-miR-4514	CLIP-seq
MIRT2267040	hsa-miR-4529-5p	CLIP-seq
MIRT2036980	hsa-miR-4675	CLIP-seq
MIRT2267041	hsa-miR-4692	CLIP-seq
MIRT2036981	hsa-miR-4741	CLIP-seq
MIRT2267039	hsa-miR-4514	CLIP-seq
MIRT2267041	hsa-miR-4692	CLIP-seq
MIRT2390589	hsa-miR-597	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005798	Component	Golgi-associated vesicle	IBA
GO:0005798	Component	Golgi-associated vesicle	IEA
GO:0005801	Component	Cis-Golgi network	IBA
GO:0005801	Component	Cis-Golgi network	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007026	Process	Negative regulation of microtubule depolymerization	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IBA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA

Other IDs

• MIM: 610593
• HGNC: 25753
• e!Ensembl: ENSG00000180834

Protein

• UniProt ID: Q9H9H5
• Protein name: MAP6 domain-containing protein 1 (21 kDa STOP-like protein) (SL21)
• Protein function: May have microtubule-stabilizing activity.
• Sequence:

  MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDS
  GRDVPLTQYQRDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPI
  GDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKK
  FTPNPSAIFQASAPRILNV

• Sequence length: 199

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
MAP6D1-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28349958	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31348270	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31348270	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for MAP6D1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MAP6D1.