Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	4217
Gene name	Mitogen-activated protein kinase kinase kinase 5
Gene symbol	MAP3K5
Synonyms (NCBI Gene)	ASK1MAPKKK5MEKK5
Chromosome	6
Chromosome location	6q23.3
Summary	Mitogen-activated protein kinase (MAPK) signaling cascades include MAPK or extracellular signal-regulated kinase (ERK), MAPK kinase (MKK or MEK), and MAPK kinase kinase (MAPKKK or MEKK). MAPKK kinase/MEKK phosphorylates and activates its downstream protei

155

Show/Hide all (155)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039091	hsa-miR-769-3p	CLASH	23622248
MIRT053208	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	23087182
MIRT556297	hsa-miR-425-5p	PAR-CLIP	21572407
MIRT556296	hsa-miR-4517	PAR-CLIP	21572407
MIRT556295	hsa-miR-208a-5p	PAR-CLIP	21572407
MIRT556294	hsa-miR-208b-5p	PAR-CLIP	21572407
MIRT556293	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT556292	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT556291	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT556290	hsa-miR-642a-3p	PAR-CLIP	21572407
MIRT556289	hsa-miR-642b-3p	PAR-CLIP	21572407
MIRT556287	hsa-miR-5191	PAR-CLIP	21572407
MIRT556288	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT556286	hsa-miR-1303	PAR-CLIP	21572407
MIRT440282	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440282	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT556286	hsa-miR-1303	PAR-CLIP	27292025
MIRT556286	hsa-miR-1303	PAR-CLIP	27292025
MIRT556293	hsa-miR-130b-5p	PAR-CLIP	27292025
MIRT556293	hsa-miR-130b-5p	PAR-CLIP	27292025
MIRT556295	hsa-miR-208a-5p	PAR-CLIP	27292025
MIRT556295	hsa-miR-208a-5p	PAR-CLIP	27292025
MIRT556294	hsa-miR-208b-5p	PAR-CLIP	27292025
MIRT556294	hsa-miR-208b-5p	PAR-CLIP	27292025
MIRT556292	hsa-miR-302b-5p	PAR-CLIP	27292025
MIRT556292	hsa-miR-302b-5p	PAR-CLIP	27292025
MIRT556291	hsa-miR-302d-5p	PAR-CLIP	27292025
MIRT556291	hsa-miR-302d-5p	PAR-CLIP	27292025
MIRT556297	hsa-miR-425-5p	PAR-CLIP	27292025
MIRT556297	hsa-miR-425-5p	PAR-CLIP	27292025
MIRT556296	hsa-miR-4517	PAR-CLIP	27292025
MIRT556296	hsa-miR-4517	PAR-CLIP	27292025
MIRT556288	hsa-miR-4753-3p	PAR-CLIP	27292025
MIRT556288	hsa-miR-4753-3p	PAR-CLIP	27292025
MIRT556287	hsa-miR-5191	PAR-CLIP	27292025
MIRT556287	hsa-miR-5191	PAR-CLIP	27292025
MIRT556290	hsa-miR-642a-3p	PAR-CLIP	27292025
MIRT556290	hsa-miR-642a-3p	PAR-CLIP	27292025
MIRT556289	hsa-miR-642b-3p	PAR-CLIP	27292025
MIRT556289	hsa-miR-642b-3p	PAR-CLIP	27292025
MIRT556297	hsa-miR-425-5p	qRT-PCR	31673240
MIRT556297	hsa-miR-425-5p	PAR-CLIP	21572407
MIRT556296	hsa-miR-4517	PAR-CLIP	21572407
MIRT556295	hsa-miR-208a-5p	PAR-CLIP	21572407
MIRT556294	hsa-miR-208b-5p	PAR-CLIP	21572407
MIRT556293	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT556292	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT556291	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT556290	hsa-miR-642a-3p	PAR-CLIP	21572407
MIRT556289	hsa-miR-642b-3p	PAR-CLIP	21572407
MIRT556287	hsa-miR-5191	PAR-CLIP	21572407
MIRT556288	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT556286	hsa-miR-1303	PAR-CLIP	21572407
MIRT1129016	hsa-miR-199a-3p	CLIP-seq
MIRT1129017	hsa-miR-199b-3p	CLIP-seq
MIRT1129018	hsa-miR-3129-5p	CLIP-seq
MIRT1129019	hsa-miR-371-5p	CLIP-seq
MIRT1129020	hsa-miR-582-5p	CLIP-seq
MIRT1129021	hsa-miR-888	CLIP-seq
MIRT1129022	hsa-miR-936	CLIP-seq
MIRT2036721	hsa-miR-30a	CLIP-seq
MIRT2036722	hsa-miR-30b	CLIP-seq
MIRT2036723	hsa-miR-30c	CLIP-seq
MIRT2036724	hsa-miR-30d	CLIP-seq
MIRT2036725	hsa-miR-30e	CLIP-seq
MIRT2036726	hsa-miR-3143	CLIP-seq
MIRT2036727	hsa-miR-3919	CLIP-seq
MIRT2036728	hsa-miR-4773	CLIP-seq
MIRT1129020	hsa-miR-582-5p	CLIP-seq
MIRT2390563	hsa-miR-130a	CLIP-seq
MIRT2390564	hsa-miR-130b	CLIP-seq
MIRT2390565	hsa-miR-22	CLIP-seq
MIRT2390566	hsa-miR-301a	CLIP-seq
MIRT2390567	hsa-miR-301b	CLIP-seq
MIRT2390568	hsa-miR-3616-5p	CLIP-seq
MIRT2390569	hsa-miR-3647-5p	CLIP-seq
MIRT2390570	hsa-miR-3666	CLIP-seq
MIRT2390571	hsa-miR-4295	CLIP-seq
MIRT2390572	hsa-miR-454	CLIP-seq
MIRT2390573	hsa-miR-4795-5p	CLIP-seq
MIRT2390574	hsa-miR-519a	CLIP-seq
MIRT2390575	hsa-miR-519b-3p	CLIP-seq
MIRT2390576	hsa-miR-519c-3p	CLIP-seq
MIRT2390577	hsa-miR-573	CLIP-seq
MIRT2438507	hsa-miR-139-5p	CLIP-seq
MIRT2036726	hsa-miR-3143	CLIP-seq
MIRT2438508	hsa-miR-323-3p	CLIP-seq
MIRT2036728	hsa-miR-4773	CLIP-seq
MIRT2438509	hsa-miR-498	CLIP-seq
MIRT2438510	hsa-miR-543	CLIP-seq
MIRT1129020	hsa-miR-582-5p	CLIP-seq
MIRT2438511	hsa-miR-642b	CLIP-seq
MIRT2438507	hsa-miR-139-5p	CLIP-seq
MIRT1129016	hsa-miR-199a-3p	CLIP-seq
MIRT1129017	hsa-miR-199b-3p	CLIP-seq
MIRT2566458	hsa-miR-19a	CLIP-seq
MIRT2566459	hsa-miR-19b	CLIP-seq
MIRT2566460	hsa-miR-3121-3p	CLIP-seq
MIRT1129018	hsa-miR-3129-5p	CLIP-seq
MIRT2566461	hsa-miR-3130-3p	CLIP-seq
MIRT2036726	hsa-miR-3143	CLIP-seq
MIRT2438508	hsa-miR-323-3p	CLIP-seq
MIRT2036727	hsa-miR-3919	CLIP-seq
MIRT2566462	hsa-miR-4330	CLIP-seq
MIRT2036728	hsa-miR-4773	CLIP-seq
MIRT2566463	hsa-miR-4793-3p	CLIP-seq
MIRT2438509	hsa-miR-498	CLIP-seq
MIRT2566464	hsa-miR-520d-5p	CLIP-seq
MIRT2566465	hsa-miR-524-5p	CLIP-seq
MIRT2438510	hsa-miR-543	CLIP-seq
MIRT2566466	hsa-miR-544	CLIP-seq
MIRT2566467	hsa-miR-548aa	CLIP-seq
MIRT2566468	hsa-miR-548ac	CLIP-seq
MIRT2566469	hsa-miR-548ae	CLIP-seq
MIRT2566470	hsa-miR-548aj	CLIP-seq
MIRT2566471	hsa-miR-548am	CLIP-seq
MIRT2566472	hsa-miR-548d-3p	CLIP-seq
MIRT2566473	hsa-miR-548x	CLIP-seq
MIRT2566474	hsa-miR-548z	CLIP-seq
MIRT2566475	hsa-miR-582-3p	CLIP-seq
MIRT1129020	hsa-miR-582-5p	CLIP-seq
MIRT2438511	hsa-miR-642b	CLIP-seq
MIRT2566476	hsa-miR-891b	CLIP-seq
MIRT1129022	hsa-miR-936	CLIP-seq
MIRT2438507	hsa-miR-139-5p	CLIP-seq
MIRT1129016	hsa-miR-199a-3p	CLIP-seq
MIRT1129017	hsa-miR-199b-3p	CLIP-seq
MIRT2566458	hsa-miR-19a	CLIP-seq
MIRT2566459	hsa-miR-19b	CLIP-seq
MIRT2566460	hsa-miR-3121-3p	CLIP-seq
MIRT1129018	hsa-miR-3129-5p	CLIP-seq
MIRT2036726	hsa-miR-3143	CLIP-seq
MIRT2438508	hsa-miR-323-3p	CLIP-seq
MIRT1129019	hsa-miR-371-5p	CLIP-seq
MIRT2036727	hsa-miR-3919	CLIP-seq
MIRT2566462	hsa-miR-4330	CLIP-seq
MIRT2036728	hsa-miR-4773	CLIP-seq
MIRT2438509	hsa-miR-498	CLIP-seq
MIRT2566464	hsa-miR-520d-5p	CLIP-seq
MIRT2566465	hsa-miR-524-5p	CLIP-seq
MIRT2438510	hsa-miR-543	CLIP-seq
MIRT2566467	hsa-miR-548aa	CLIP-seq
MIRT2566468	hsa-miR-548ac	CLIP-seq
MIRT2566469	hsa-miR-548ae	CLIP-seq
MIRT2566470	hsa-miR-548aj	CLIP-seq
MIRT2566471	hsa-miR-548am	CLIP-seq
MIRT2566472	hsa-miR-548d-3p	CLIP-seq
MIRT2566473	hsa-miR-548x	CLIP-seq
MIRT2566474	hsa-miR-548z	CLIP-seq
MIRT2566475	hsa-miR-582-3p	CLIP-seq
MIRT1129020	hsa-miR-582-5p	CLIP-seq
MIRT2438511	hsa-miR-642b	CLIP-seq
MIRT1129021	hsa-miR-888	CLIP-seq
MIRT2566476	hsa-miR-891b	CLIP-seq
MIRT1129022	hsa-miR-936	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
E2F1	Activation	16476732;17287612
E2F1	Unknown	16512785;19610065
E2F2	Unknown	16512785
E2F3	Unknown	16512785
E2F4	Unknown	16512785
RB1	Unknown	19610065

Show/Hide all (79)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	17210579, 21771788
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	TAS	8974401
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	17210579
GO:0002376	Process	Immune system process	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0004672	Function	Protein kinase activity	IDA	11096076, 21771788
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004706	Function	JUN kinase kinase kinase activity	IDA	11959862
GO:0004709	Function	MAP kinase kinase kinase activity	IBA
GO:0004709	Function	MAP kinase kinase kinase activity	IDA	15983381, 17210579
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0004709	Function	MAP kinase kinase kinase activity	TAS	8974401
GO:0005515	Function	Protein binding	IPI	9743501, 11003656, 11154276, 11298454, 11495919, 12556535, 12813029, 14557248, 14761963, 15023544, 15246877, 16449798, 16636664, 16648474, 17210579, 17389591, 17700517, 17761141, 19590015, 19782076, 19805025, 19935702, 21496457, 21771788, 22095282, 22609355, 25241761, 25852190, 2609
GO:0005524	Function	ATP binding	IDA	17210579
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	26095851
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IDA	11959862, 21771788
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	IMP	22095282
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IBA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IDA	21771788, 26095851
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	11959862, 20674765
GO:0019904	Function	Protein domain specific binding	IPI	11096076
GO:0032991	Component	Protein-containing complex	IMP	11096076
GO:0034198	Process	Cellular response to amino acid starvation	IDA	11096076
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	23000344
GO:0036480	Process	Neuron intrinsic apoptotic signaling pathway in response to oxidative stress	IGI	15983381
GO:0038066	Process	P38MAPK cascade	IBA
GO:0038066	Process	P38MAPK cascade	IEA
GO:0042802	Function	Identical protein binding	IPI	9743501, 17937911, 19805025
GO:0042803	Function	Protein homodimerization activity	IDA	11920685
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21771788
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043067	Process	Regulation of programmed cell death	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11096076
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	23000344
GO:0046330	Process	Positive regulation of JNK cascade	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051402	Process	Neuron apoptotic process	IBA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11096076
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IBA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	20674765
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0072577	Process	Endothelial cell apoptotic process	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0097190	Process	Apoptotic signaling pathway	IDA	20674765
GO:0097190	Process	Apoptotic signaling pathway	TAS	8974401
GO:0097300	Process	Programmed necrotic cell death	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IEA
GO:1902170	Process	Cellular response to reactive nitrogen species	IEA
GO:1902911	Component	Protein kinase complex	IDA	15983381
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1990604	Component	IRE1-TRAF2-ASK1 complex	IDA	12050113, 23000344

MIM	HGNC	e!Ensembl
602448	6857	ENSG00000197442

Q99683

Protein name

Mitogen-activated protein kinase kinase kinase 5 (EC 2.7.11.25) (Apoptosis signal-regulating kinase 1) (ASK-1) (MAPK/ERK kinase kinase 5) (MEK kinase 5) (MEKK 5)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the cascades of cellular responses evoked by changes in the environment. Mediates signaling for determination

PDB

2CLQ , 3VW6 , 4BF2 , 4BHN , 4BIB , 4BIC , 4BID , 4BIE , 5ULM , 5UOR , 5UOX , 5UP3 , 5V19 , 5V24 , 5VIL , 5VIO , 6E2M , 6E2N , 6E2O , 6EJL , 6OYT , 6OYW , 6VRE , 6XIH , 7MU6 , 7MU7 , 8QGY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13281	DUF4071	165 → 545	Domain of unknown function (DUF4071)	Family
PF19039	ASK_PH	555 → 654	ASK kinase PH domain	Domain
PF00069	Pkinase	682 → 938	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in heart and pancreas.

Sequence

MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESA
AAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREAC
ETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANN
IILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQP
NFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIR
QRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALN
RRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGF
FLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVD
FWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIH
EWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRS
TEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQ
PLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTI
GFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVH
PEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNE
YLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGI
PDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEP
KLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNK
VLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEE
QPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVN
GADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT

Sequence length

1374

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (162)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30508644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29381295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22119000, 29627323, 31482248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23873136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17115886, 27826954, 28345767, 28360100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16331767, 20609399, 29408488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22736089, 24831789, 26134265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17115886, 27826954, 28345767, 28360100		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31411368, 31561314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29475459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23000344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22925655, 26191261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22095282, 22925655, 26191261, 36323529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24082073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18932288, 26707143, 29445085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23000344, 25797626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29381295, 31807521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34071938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19940360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14500571, 28931753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	18342293		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	18342293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28551792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23776076, 31619063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23137546, 28855861, 29743976, 30172704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18688015, 23137546, 24284943		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28537893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26191261, 28537893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	23892595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22740450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30006481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28284893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30617854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19931259, 29555502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17342315, 21725208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21725208, 29940575, 33907844, 35590292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28337323, 28551792, 29259759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19940360, 28284893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33739303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniometaphyseal Dysplasia Autosomal Dominant	Craniometaphyseal dysplasia	Pubtator	33739303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29408488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29592844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	21064192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	24736726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17115886, 19351724, 23416061, 29627323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	16731828		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17115886, 19351724, 23416061, 29627323		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	20185809, 33739303	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20185809, 33902539, 39383866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20185809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27226108, 30024858, 31154867, 31196660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	22925655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28508477, 28739531, 31171651, 31595673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28346237, 28677333, 29227477, 29247356, 30063256, 30315846, 30703849, 31171651, 31222801, 31595673, 31612792, 31705800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	14668338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31171651, 31595673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	24082073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27615513, 28270908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23020756, 33920356, 36951032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	23940728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	30508644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22824861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	24831789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28337323, 28551792, 29259759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18327563, 19022249		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	16731828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33739303, 37561089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28910144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	31578081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28910144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30617854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20185809, 28604593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28855861, 29743976, 30172704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27226108, 30024858, 31196660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15374708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29996811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29996811, 30508644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	31525533		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	19449367, 21117066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16644673, 26707143, 27050273, 29445085, 31569678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33223956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26165383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16644673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26165383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26165383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30324658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	15034865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22925655, 26191261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29381295, 31807521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14500571, 28931753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22530568, 27655673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20035634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23110662, 30324658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23000344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19931259, 23776076, 27655673, 30496488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28537893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17342315, 21725208, 28931753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	30402980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17287612, 22197930, 24008424	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	22197930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	24008424		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	28218919, 28508477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	33739303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22197930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	19903888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33763469, 34895315, 36122664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22723553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21064192, 28040492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	16093456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	19073171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	18342293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28243335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32083569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	20716917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	20716917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17342315, 19931259, 27050273, 28537893, 28753204, 28931753, 30324658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29998485		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30496488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	23982205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11598801, 16515547, 20358250, 27890558, 28647884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24831789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20202476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29729191, 30063256, 31171651, 31595673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28892558, 29227477, 29600430, 30315846, 30703849, 31222801, 31612792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28702328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33902539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	28040492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33778083, 36105394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18822283, 23219526, 25848766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18822283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37285835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35295989	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14500571, 28931753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36122664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22530568, 27655673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16532036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29274137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16515547, 19293155, 21209210, 21815648, 28888991, 31734439		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	16515547		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	16515547	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	21815648		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pemphigus	Pemphigus	Pubtator	33763469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	29742502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28210980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20035634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20035634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28910144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30006481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19940360, 28284893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16331767, 20609399, 29408488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	20877355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26796273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24205072, 34853622, 36916400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28218919, 28508477, 28739531, 29107687, 31171651, 31595673, 31705800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23110662, 30324658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24082073, 25198898, 30324658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29334839		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	24649974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29274137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27342319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26191261, 40253372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	24410795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP3K5 (mitogen-activated protein kinase kinase kinase 5)