Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	9020
Gene name	Mitogen-activated protein kinase kinase kinase 14
Gene symbol	MAP3K14
Synonyms (NCBI Gene)	FTDCR1BHSHSNIKIMD112NIK
Chromosome	17
Chromosome location	17q21.31
Summary	This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates

203

Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020850	hsa-miR-155-5p	Reporter assay	20584899
MIRT052929	hsa-miR-520e	5.0	22105365
MIRT052929	hsa-miR-520e	5.0	22105365
MIRT440287	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT020850	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT440286	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440287	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT020850	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT727256	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727255	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT727254	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727253	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT727252	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727251	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT440286	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT1128496	hsa-miR-106a	CLIP-seq
MIRT1128497	hsa-miR-106b	CLIP-seq
MIRT1128498	hsa-miR-1203	CLIP-seq
MIRT1128499	hsa-miR-1207-5p	CLIP-seq
MIRT1128500	hsa-miR-1228	CLIP-seq
MIRT1128501	hsa-miR-1245b-3p	CLIP-seq
MIRT1128502	hsa-miR-1248	CLIP-seq
MIRT1128503	hsa-miR-1304	CLIP-seq
MIRT1128504	hsa-miR-133a	CLIP-seq
MIRT1128505	hsa-miR-133b	CLIP-seq
MIRT1128506	hsa-miR-146a	CLIP-seq
MIRT1128507	hsa-miR-146b-5p	CLIP-seq
MIRT1128508	hsa-miR-17	CLIP-seq
MIRT1128509	hsa-miR-20a	CLIP-seq
MIRT1128510	hsa-miR-20b	CLIP-seq
MIRT1128511	hsa-miR-223	CLIP-seq
MIRT1128512	hsa-miR-302a	CLIP-seq
MIRT1128513	hsa-miR-302b	CLIP-seq
MIRT1128514	hsa-miR-302c	CLIP-seq
MIRT1128515	hsa-miR-302d	CLIP-seq
MIRT1128516	hsa-miR-302e	CLIP-seq
MIRT1128517	hsa-miR-3117-5p	CLIP-seq
MIRT1128518	hsa-miR-3126-5p	CLIP-seq
MIRT1128519	hsa-miR-3138	CLIP-seq
MIRT1128520	hsa-miR-3151	CLIP-seq
MIRT1128521	hsa-miR-3176	CLIP-seq
MIRT1128522	hsa-miR-3180	CLIP-seq
MIRT1128523	hsa-miR-3180-3p	CLIP-seq
MIRT1128524	hsa-miR-3189-3p	CLIP-seq
MIRT1128525	hsa-miR-3195	CLIP-seq
MIRT1128526	hsa-miR-3196	CLIP-seq
MIRT1128527	hsa-miR-329	CLIP-seq
MIRT1128528	hsa-miR-342-3p	CLIP-seq
MIRT1128529	hsa-miR-345	CLIP-seq
MIRT1128530	hsa-miR-362-3p	CLIP-seq
MIRT1128531	hsa-miR-3659	CLIP-seq
MIRT1128532	hsa-miR-371-3p	CLIP-seq
MIRT1128533	hsa-miR-372	CLIP-seq
MIRT1128534	hsa-miR-373	CLIP-seq
MIRT1128535	hsa-miR-3922-3p	CLIP-seq
MIRT1128536	hsa-miR-3941	CLIP-seq
MIRT1128537	hsa-miR-4274	CLIP-seq
MIRT1128538	hsa-miR-4283	CLIP-seq
MIRT1128539	hsa-miR-4302	CLIP-seq
MIRT1128540	hsa-miR-4419a	CLIP-seq
MIRT1128541	hsa-miR-4435	CLIP-seq
MIRT1128542	hsa-miR-4436b-3p	CLIP-seq
MIRT1128543	hsa-miR-4471	CLIP-seq
MIRT1128544	hsa-miR-4488	CLIP-seq
MIRT1128545	hsa-miR-4489	CLIP-seq
MIRT1128546	hsa-miR-4491	CLIP-seq
MIRT1128547	hsa-miR-4492	CLIP-seq
MIRT1128548	hsa-miR-4498	CLIP-seq
MIRT1128549	hsa-miR-4505	CLIP-seq
MIRT1128550	hsa-miR-4508	CLIP-seq
MIRT1128551	hsa-miR-4510	CLIP-seq
MIRT1128552	hsa-miR-4520a-3p	CLIP-seq
MIRT1128553	hsa-miR-455-5p	CLIP-seq
MIRT1128554	hsa-miR-4639-3p	CLIP-seq
MIRT1128555	hsa-miR-4657	CLIP-seq
MIRT1128556	hsa-miR-4658	CLIP-seq
MIRT1128557	hsa-miR-466	CLIP-seq
MIRT1128558	hsa-miR-4672	CLIP-seq
MIRT1128559	hsa-miR-4688	CLIP-seq
MIRT1128560	hsa-miR-4697-3p	CLIP-seq
MIRT1128561	hsa-miR-4697-5p	CLIP-seq
MIRT1128562	hsa-miR-4707-5p	CLIP-seq
MIRT1128563	hsa-miR-4727-3p	CLIP-seq
MIRT1128564	hsa-miR-4728-3p	CLIP-seq
MIRT1128565	hsa-miR-4731-5p	CLIP-seq
MIRT1128566	hsa-miR-4763-3p	CLIP-seq
MIRT1128567	hsa-miR-4800-5p	CLIP-seq
MIRT1128568	hsa-miR-486-3p	CLIP-seq
MIRT1128569	hsa-miR-514	CLIP-seq
MIRT1128570	hsa-miR-514b-3p	CLIP-seq
MIRT1128571	hsa-miR-519d	CLIP-seq
MIRT1128572	hsa-miR-520a-3p	CLIP-seq
MIRT1128573	hsa-miR-520b	CLIP-seq
MIRT1128574	hsa-miR-520c-3p	CLIP-seq
MIRT1128575	hsa-miR-520d-3p	CLIP-seq
MIRT1128576	hsa-miR-520f	CLIP-seq
MIRT1128577	hsa-miR-574-5p	CLIP-seq
MIRT1128578	hsa-miR-589	CLIP-seq
MIRT1128579	hsa-miR-603	CLIP-seq
MIRT1128580	hsa-miR-622	CLIP-seq
MIRT1128581	hsa-miR-637	CLIP-seq
MIRT1128582	hsa-miR-759	CLIP-seq
MIRT1128583	hsa-miR-762	CLIP-seq
MIRT1128584	hsa-miR-9	CLIP-seq
MIRT1128585	hsa-miR-93	CLIP-seq
MIRT1128586	hsa-miR-938	CLIP-seq
MIRT1128503	hsa-miR-1304	CLIP-seq
MIRT2036495	hsa-miR-146b-3p	CLIP-seq
MIRT1128520	hsa-miR-3151	CLIP-seq
MIRT2036496	hsa-miR-3173-5p	CLIP-seq
MIRT2036497	hsa-miR-3616-3p	CLIP-seq
MIRT1128542	hsa-miR-4436b-3p	CLIP-seq
MIRT2036498	hsa-miR-4722-3p	CLIP-seq
MIRT1128568	hsa-miR-486-3p	CLIP-seq
MIRT2036499	hsa-miR-874	CLIP-seq
MIRT1128496	hsa-miR-106a	CLIP-seq
MIRT1128497	hsa-miR-106b	CLIP-seq
MIRT1128499	hsa-miR-1207-5p	CLIP-seq
MIRT2266774	hsa-miR-125a-3p	CLIP-seq
MIRT1128503	hsa-miR-1304	CLIP-seq
MIRT1128508	hsa-miR-17	CLIP-seq
MIRT2266775	hsa-miR-182	CLIP-seq
MIRT1128509	hsa-miR-20a	CLIP-seq
MIRT1128510	hsa-miR-20b	CLIP-seq
MIRT2266776	hsa-miR-2110	CLIP-seq
MIRT2266777	hsa-miR-24	CLIP-seq
MIRT2266778	hsa-miR-2467-5p	CLIP-seq
MIRT2266779	hsa-miR-299-3p	CLIP-seq
MIRT2266780	hsa-miR-31	CLIP-seq
MIRT1128520	hsa-miR-3151	CLIP-seq
MIRT2266781	hsa-miR-3166	CLIP-seq
MIRT2266782	hsa-miR-3188	CLIP-seq
MIRT2266783	hsa-miR-3194-3p	CLIP-seq
MIRT2266784	hsa-miR-326	CLIP-seq
MIRT2266785	hsa-miR-330-5p	CLIP-seq
MIRT2266786	hsa-miR-3934	CLIP-seq
MIRT2266787	hsa-miR-3975	CLIP-seq
MIRT2266788	hsa-miR-4271	CLIP-seq
MIRT2266789	hsa-miR-431	CLIP-seq
MIRT1128542	hsa-miR-4436b-3p	CLIP-seq
MIRT2266790	hsa-miR-4437	CLIP-seq
MIRT2266791	hsa-miR-4640-3p	CLIP-seq
MIRT2266792	hsa-miR-4667-5p	CLIP-seq
MIRT1128559	hsa-miR-4688	CLIP-seq
MIRT2266793	hsa-miR-4700-5p	CLIP-seq
MIRT2266794	hsa-miR-4725-3p	CLIP-seq
MIRT2266795	hsa-miR-4732-3p	CLIP-seq
MIRT1128566	hsa-miR-4763-3p	CLIP-seq
MIRT2266796	hsa-miR-485-5p	CLIP-seq
MIRT1128568	hsa-miR-486-3p	CLIP-seq
MIRT1128571	hsa-miR-519d	CLIP-seq
MIRT2266797	hsa-miR-576-3p	CLIP-seq
MIRT2266798	hsa-miR-621	CLIP-seq
MIRT2266799	hsa-miR-626	CLIP-seq
MIRT2266800	hsa-miR-634	CLIP-seq
MIRT1128581	hsa-miR-637	CLIP-seq
MIRT2266801	hsa-miR-654-3p	CLIP-seq
MIRT2266802	hsa-miR-764	CLIP-seq
MIRT1128585	hsa-miR-93	CLIP-seq
MIRT1128500	hsa-miR-1228	CLIP-seq
MIRT1128502	hsa-miR-1248	CLIP-seq
MIRT2566343	hsa-miR-1254	CLIP-seq
MIRT1128504	hsa-miR-133a	CLIP-seq
MIRT1128505	hsa-miR-133b	CLIP-seq
MIRT2566344	hsa-miR-3116	CLIP-seq
MIRT1128517	hsa-miR-3117-5p	CLIP-seq
MIRT1128524	hsa-miR-3189-3p	CLIP-seq
MIRT1128527	hsa-miR-329	CLIP-seq
MIRT1128528	hsa-miR-342-3p	CLIP-seq
MIRT1128530	hsa-miR-362-3p	CLIP-seq
MIRT2566345	hsa-miR-3664-3p	CLIP-seq
MIRT1128536	hsa-miR-3941	CLIP-seq
MIRT2566346	hsa-miR-4254	CLIP-seq
MIRT2566347	hsa-miR-4257	CLIP-seq
MIRT2566348	hsa-miR-4436a	CLIP-seq
MIRT1128554	hsa-miR-4639-3p	CLIP-seq
MIRT1128557	hsa-miR-466	CLIP-seq
MIRT1128558	hsa-miR-4672	CLIP-seq
MIRT2566349	hsa-miR-4684-3p	CLIP-seq
MIRT2566350	hsa-miR-4710	CLIP-seq
MIRT2566351	hsa-miR-492	CLIP-seq
MIRT2566352	hsa-miR-510	CLIP-seq
MIRT1128579	hsa-miR-603	CLIP-seq
MIRT2566353	hsa-miR-647	CLIP-seq
MIRT1128584	hsa-miR-9	CLIP-seq
MIRT1128500	hsa-miR-1228	CLIP-seq
MIRT1128502	hsa-miR-1248	CLIP-seq
MIRT1128504	hsa-miR-133a	CLIP-seq
MIRT1128505	hsa-miR-133b	CLIP-seq
MIRT1128524	hsa-miR-3189-3p	CLIP-seq
MIRT1128527	hsa-miR-329	CLIP-seq
MIRT1128530	hsa-miR-362-3p	CLIP-seq
MIRT2566345	hsa-miR-3664-3p	CLIP-seq
MIRT1128536	hsa-miR-3941	CLIP-seq
MIRT2566347	hsa-miR-4257	CLIP-seq
MIRT2566348	hsa-miR-4436a	CLIP-seq
MIRT1128557	hsa-miR-466	CLIP-seq
MIRT1128558	hsa-miR-4672	CLIP-seq
MIRT2566351	hsa-miR-492	CLIP-seq
MIRT2566352	hsa-miR-510	CLIP-seq
MIRT1128579	hsa-miR-603	CLIP-seq
MIRT2566353	hsa-miR-647	CLIP-seq
MIRT1128584	hsa-miR-9	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HSF1	Unknown	19381566

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0004672	Function	Protein kinase activity	IDA	15001576
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	9520446
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	9020361, 9520446, 10733566, 12884866, 14743216, 16286467, 16498412, 17158868, 17237370, 22939624, 25036637, 25241761, 25416956, 28514442, 30833792, 31980649, 32296183, 32707033, 32814053, 33961781, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IMP	10094049
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	ISS
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	TAS
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
604655	6853	ENSG00000006062

Q99558

Protein name

Mitogen-activated protein kinase kinase kinase 14 (EC 2.7.11.25) (NF-kappa-beta-inducing kinase) (HsNIK) (Serine/threonine-protein kinase NIK)

Protein function

Lymphotoxin beta-activated kinase which seems to be exclusively involved in the activation of NF-kappa-B and its transcriptional activity. Phosphorylates CHUK/IKKA, thereby promoting proteolytic processing of NFKB2/P100, which leads to NF-kappa-

PDB

4DN5 , 4G3D , 4IDT , 4IDV , 6WPP , 6Z1Q , 6Z1T , 8YHW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	401 → 649	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Weakly expressed in testis, small intestine, spleen, thymus, peripheral blood leukocytes, prostate, ovary and colon. {ECO:0000269|PubMed:9020361}.

Sequence

MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQE
DESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVW
KLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQKPLPDPH
LSKLACVDSPKPLPGPHLEPSCLSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTW
AARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDK
QTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
VKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFF
RGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGG
LKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPGPRPAEETTGRAPKLQPPLPPE
PPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATVPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP

Sequence length

947

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency 112	Pathogenic	rs773929665	RCV004525819	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NIK deficiency	Likely pathogenic	rs2143820144	RCV001978448	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAP3K14-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (84)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Agammaglobulinemia	Agammaglobulinemia	Pubtator	25406581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25963989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29407886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37931331, 39766197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21315692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22417847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25920913, 26513020, 27876836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19538528, 20735436, 26823811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32000390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17711513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22417847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23301098, 33525943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37455213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	29407886	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25812680, 28982739, 34573430, 39379942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24776844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptosporidiosis	Cryptosporidiosis	Pubtator	25406581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	30396963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30248539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21846802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25371288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20889926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	18056702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25811593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31516617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31516617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	9799091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	29329668	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33723235, 37567906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22745752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28498444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	30488488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	31870133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31363036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	31363036	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	20339089, 22469134, 22968463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21846802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	20004765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27620989, 31196660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	29283461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21820422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28498444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26823811	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24362935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	25406581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25920913, 26513020, 27876836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31516617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29366808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28498444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22417847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11510478, 25704885, 25920913, 28352193, 28498444, 30031856, 30837284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11773061, 18347013, 34638912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22948084, 28352193, 29100459, 30396963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	39766197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	20004765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17692804, 17692805, 24980832, 29654269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29654269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30089311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35173708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis, Type 3, mixed central and peripheral	Neurofibromatosis	BEFREE	26430762		★★★★★ ★☆☆☆☆ Found in Text Mining only
NIK deficiency	NIK Deficiency	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29731854, 30195659, 31586084, 31715289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12473591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29366808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19502791, 22078386, 23301098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	38273351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29387247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	9799091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	24894018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33224973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	25406581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	12668260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18752500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33509203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31086184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23797008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	35027554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	18166586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30488488, 40650045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32000390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24776844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35711565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34894925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP3K14 (mitogen-activated protein kinase kinase kinase 14)