Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7786
Gene name	Mitogen-activated protein kinase kinase kinase 12
Gene symbol	MAP3K12
Synonyms (NCBI Gene)	DLKHP09298MEKK12MUKZPKZPKP1
Chromosome	12
Chromosome location	12q13.13
Summary	This gene encodes a member of the serine/threonine protein kinase family. This kinase contains a leucine-zipper domain and is predominately expressed in neuronal cells. The phosphorylation state of this kinase in synaptic terminals was shown to be regulat

160 Show/Hide all (160)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003013	hsa-miR-17-5p	Luciferase reporter assay	19666108
MIRT003013	hsa-miR-17-5p	Luciferase reporter assay	19666108
MIRT003010	hsa-miR-20a-5p	Luciferase reporter assay	19666108
MIRT003010	hsa-miR-20a-5p	Luciferase reporter assay	19666108
MIRT029590	hsa-miR-26b-5p	Microarray	19088304
MIRT511196	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT511196	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT511197	hsa-miR-32-3p	HITS-CLIP	21572407
MIRT511195	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT522632	hsa-miR-6722-5p	HITS-CLIP	21572407
MIRT511194	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT511193	hsa-miR-3924	HITS-CLIP	21572407
MIRT511192	hsa-miR-6083	HITS-CLIP	21572407
MIRT511191	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT511197	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT511196	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT522632	hsa-miR-6722-5p	PAR-CLIP	20371350
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT511193	hsa-miR-3924	PAR-CLIP	20371350
MIRT511192	hsa-miR-6083	PAR-CLIP	20371350
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT511197	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT511196	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT522632	hsa-miR-6722-5p	PAR-CLIP	21572407
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT511193	hsa-miR-3924	PAR-CLIP	21572407
MIRT511192	hsa-miR-6083	PAR-CLIP	21572407
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511196	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT511196	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT511197	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522632	hsa-miR-6722-5p	PAR-CLIP	23446348
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511193	hsa-miR-3924	PAR-CLIP	23446348
MIRT511192	hsa-miR-6083	PAR-CLIP	23446348
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511197	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT511196	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511193	hsa-miR-3924	PAR-CLIP	23446348
MIRT511192	hsa-miR-6083	PAR-CLIP	23446348
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511196	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT511196	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT511197	hsa-miR-32-3p	HITS-CLIP	21572407
MIRT511195	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT522632	hsa-miR-6722-5p	HITS-CLIP	21572407
MIRT511194	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT511193	hsa-miR-3924	HITS-CLIP	21572407
MIRT511192	hsa-miR-6083	HITS-CLIP	21572407
MIRT511191	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT511197	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT511196	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT522632	hsa-miR-6722-5p	PAR-CLIP	20371350
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT511193	hsa-miR-3924	PAR-CLIP	20371350
MIRT511192	hsa-miR-6083	PAR-CLIP	20371350
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT511197	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT511196	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT522632	hsa-miR-6722-5p	PAR-CLIP	21572407
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT511193	hsa-miR-3924	PAR-CLIP	21572407
MIRT511192	hsa-miR-6083	PAR-CLIP	21572407
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT511196	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT511196	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT511197	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522632	hsa-miR-6722-5p	PAR-CLIP	23446348
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511193	hsa-miR-3924	PAR-CLIP	23446348
MIRT511192	hsa-miR-6083	PAR-CLIP	23446348
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT511197	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT511196	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT511195	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511194	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT511193	hsa-miR-3924	PAR-CLIP	23446348
MIRT511192	hsa-miR-6083	PAR-CLIP	23446348
MIRT511191	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1128188	hsa-miR-3065-3p	CLIP-seq
MIRT1128189	hsa-miR-30a	CLIP-seq
MIRT1128190	hsa-miR-30b	CLIP-seq
MIRT1128191	hsa-miR-30c	CLIP-seq
MIRT1128192	hsa-miR-30d	CLIP-seq
MIRT1128193	hsa-miR-30e	CLIP-seq
MIRT1128194	hsa-miR-4698	CLIP-seq
MIRT1128195	hsa-miR-4797-5p	CLIP-seq
MIRT1128196	hsa-miR-553	CLIP-seq
MIRT2036468	hsa-miR-299-3p	CLIP-seq
MIRT2036469	hsa-miR-4491	CLIP-seq
MIRT2036470	hsa-miR-4657	CLIP-seq
MIRT1128188	hsa-miR-3065-3p	CLIP-seq
MIRT2453667	hsa-miR-3157-5p	CLIP-seq
MIRT2453668	hsa-miR-4293	CLIP-seq
MIRT2453669	hsa-miR-4717-3p	CLIP-seq
MIRT2453670	hsa-miR-671-3p	CLIP-seq
MIRT2566316	hsa-miR-1253	CLIP-seq
MIRT2566317	hsa-miR-208a	CLIP-seq
MIRT2566318	hsa-miR-208b	CLIP-seq
MIRT2566319	hsa-miR-2861	CLIP-seq
MIRT1128188	hsa-miR-3065-3p	CLIP-seq
MIRT2566320	hsa-miR-3150a-5p	CLIP-seq
MIRT2566321	hsa-miR-3150b-5p	CLIP-seq
MIRT2453667	hsa-miR-3157-5p	CLIP-seq
MIRT2566322	hsa-miR-3158-3p	CLIP-seq
MIRT2566323	hsa-miR-331-3p	CLIP-seq
MIRT2566324	hsa-miR-3617	CLIP-seq
MIRT2566325	hsa-miR-3919	CLIP-seq
MIRT2566326	hsa-miR-4292	CLIP-seq
MIRT2453668	hsa-miR-4293	CLIP-seq
MIRT2566327	hsa-miR-4648	CLIP-seq
MIRT2566328	hsa-miR-4694-3p	CLIP-seq
MIRT2453669	hsa-miR-4717-3p	CLIP-seq
MIRT2566329	hsa-miR-499-5p	CLIP-seq
MIRT2566330	hsa-miR-522	CLIP-seq
MIRT2566331	hsa-miR-541	CLIP-seq
MIRT2566332	hsa-miR-577	CLIP-seq
MIRT2566333	hsa-miR-622	CLIP-seq
MIRT2566334	hsa-miR-635	CLIP-seq
MIRT2566335	hsa-miR-641	CLIP-seq
MIRT2566336	hsa-miR-654-5p	CLIP-seq
MIRT2453670	hsa-miR-671-3p	CLIP-seq
MIRT2566316	hsa-miR-1253	CLIP-seq
MIRT2684472	hsa-miR-1302	CLIP-seq
MIRT2566317	hsa-miR-208a	CLIP-seq
MIRT2566318	hsa-miR-208b	CLIP-seq
MIRT2566319	hsa-miR-2861	CLIP-seq
MIRT1128188	hsa-miR-3065-3p	CLIP-seq
MIRT2566320	hsa-miR-3150a-5p	CLIP-seq
MIRT2566321	hsa-miR-3150b-5p	CLIP-seq
MIRT2453667	hsa-miR-3157-5p	CLIP-seq
MIRT2566322	hsa-miR-3158-3p	CLIP-seq
MIRT2566323	hsa-miR-331-3p	CLIP-seq
MIRT2684473	hsa-miR-3613-3p	CLIP-seq
MIRT2566324	hsa-miR-3617	CLIP-seq
MIRT2684474	hsa-miR-3662	CLIP-seq
MIRT2566325	hsa-miR-3919	CLIP-seq
MIRT2566326	hsa-miR-4292	CLIP-seq
MIRT2453668	hsa-miR-4293	CLIP-seq
MIRT2684475	hsa-miR-4298	CLIP-seq
MIRT2566327	hsa-miR-4648	CLIP-seq
MIRT2566328	hsa-miR-4694-3p	CLIP-seq
MIRT2453669	hsa-miR-4717-3p	CLIP-seq
MIRT2566329	hsa-miR-499-5p	CLIP-seq
MIRT2566330	hsa-miR-522	CLIP-seq
MIRT2566331	hsa-miR-541	CLIP-seq
MIRT2566332	hsa-miR-577	CLIP-seq
MIRT2566333	hsa-miR-622	CLIP-seq
MIRT2566334	hsa-miR-635	CLIP-seq
MIRT2566335	hsa-miR-641	CLIP-seq
MIRT2566336	hsa-miR-654-5p	CLIP-seq
MIRT2453670	hsa-miR-671-3p	CLIP-seq

44 Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8637721, 8663324
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS	9353328
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 20029029, 31980649
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8663324
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	8663324
GO:0006468	Process	Protein phosphorylation	IDA	14697235
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	ISS	9353328
GO:0007254	Process	JNK cascade	TAS	8637721
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS	9353328
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IPI	14697235
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	7983011
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	ISS
GO:0043687	Process	Post-translational protein modification	IEA
GO:0043687	Process	Post-translational protein modification	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	28111074
GO:0046777	Process	Protein autophosphorylation	ISS	9353328
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	28111074
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA

MIM	HGNC	e!Ensembl
600447	6851	ENSG00000139625

Q12852

Protein name

Mitogen-activated protein kinase kinase kinase 12 (EC 2.7.11.25) (Dual leucine zipper bearing kinase) (DLK) (Leucine-zipper protein kinase) (ZPK) (MAPK-upstream kinase) (MUK) (Mixed lineage kinase)

Protein function

Part of a non-canonical MAPK signaling pathway (PubMed:28111074). Activated by APOE, enhances the AP-1-mediated transcription of APP, via a MAP kinase signal transduction pathway composed of MAP2K7 and MAPK1/ERK2 and MAPK3/ERK1 (PubMed:28111074)

PDB

5CEN , 5CEO , 5CEP , 5CEQ , 5VO1 , 5VO2 , 8DEG , 8OUR , 8OUS , 8OUT , 9CDX , 9CDY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	127 → 364	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain and kidney. {ECO:0000269|PubMed:8037767}.

Sequence

MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTHVLQLHEQDAGGPGG
AAGSPESRASRVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEV
PFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVC
TQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSP
NMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVL
WELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQI
LLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR
HALDIREHYERKLERANNLYMELNALMLQLELKERELLRREQALERRCPGLLKPHPSRGL
LHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRS
RRGKTRHRKASAKGSCGDLPGLRTAVPPHEPGGPGSPGGLGGGPSAWEACPPALRGLHHD
LLLRKMSSSSPDLLSAALGSRGRGATGGAGDPGSPPPARGDTPPSEGSAPGSTSPDSPGG
AKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAGSQHLTPAALLYRAAVTRSQKRGISSE
EEEGEVDSEVELTSSQRWPQSLNMRQSLSTFSSENPSDGEEGTASEPSPSGTPEVGSTNT
DERPDERSDDMCSQGSEIPLDPPPSEVIPGPEPSSLPIPHQELLRERGPPNSEDSDCDST
ELDNSNSVDALRPPASLPP

Sequence length

859

Interactions

View interactions

KEGG Pathway
MAPK signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Delayed speech and language development	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Falls	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (22)
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22897724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22897724		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19666108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18497756, 28507808, 9150946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28588700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22897724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11549352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25999017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	15605081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11549352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19200579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	12909487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18497756, 28507808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28588700		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28507808		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11435312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15605081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15605081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30842471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28929759, 29863360, 30053694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19691116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28396258		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with MAP3K12 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for MAP3K12.

Diseases Linked via Similar Genes Diseases curated for genes most similar to MAP3K12 (see Related Genes above), that are NOT already directly curated for MAP3K12 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to MAP3K12.

MAP3K12 (mitogen-activated protein kinase kinase kinase 12)

Bookmark This Gene