MAP3K10 (mitogen-activated protein kinase kinase kinase 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4294
• Gene name: Mitogen-activated protein kinase kinase kinase 10
• Gene symbol: MAP3K10
• Synonyms (NCBI Gene): MEKK10, MLK2, MST
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase has been shown to activate MAPK8/JNK and MKK4/SEK1, and this kinase itself can be phoshorylated, and thus activated by JNK kinases. This kinase functions prefe

miRNA Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005545	hsa-miR-181b-5p	qRT-PCR, Western blot	20596961
MIRT005545	hsa-miR-181b-5p	qRT-PCR, Western blot	20596961
MIRT007103	hsa-miR-155-5p	Luciferase reporter assay	23189122
MIRT007103	hsa-miR-155-5p	Luciferase reporter assay	23189122
MIRT007103	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT042327	hsa-miR-484	CLASH	23622248
MIRT053691	hsa-miR-181a-5p	Microarray	22942087
MIRT007103	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT007103	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT732536	hsa-miR-146b-3p	Microarray, qRT-PCR, Western blotting	33995647
MIRT2036441	hsa-miR-1207-5p	CLIP-seq
MIRT2036442	hsa-miR-1915	CLIP-seq
MIRT2036443	hsa-miR-361-3p	CLIP-seq
MIRT2036444	hsa-miR-3918	CLIP-seq
MIRT2036445	hsa-miR-4492	CLIP-seq
MIRT2036446	hsa-miR-4498	CLIP-seq
MIRT2036447	hsa-miR-4505	CLIP-seq
MIRT2036448	hsa-miR-4512	CLIP-seq
MIRT2036449	hsa-miR-4685-5p	CLIP-seq
MIRT2036450	hsa-miR-4722-3p	CLIP-seq
MIRT2036451	hsa-miR-4731-5p	CLIP-seq
MIRT2036452	hsa-miR-4763-3p	CLIP-seq
MIRT2036453	hsa-miR-4793-5p	CLIP-seq
MIRT2036454	hsa-miR-486-3p	CLIP-seq
MIRT2036455	hsa-miR-762	CLIP-seq
MIRT2036441	hsa-miR-1207-5p	CLIP-seq
MIRT2266701	hsa-miR-1224-3p	CLIP-seq
MIRT2036442	hsa-miR-1915	CLIP-seq
MIRT2036443	hsa-miR-361-3p	CLIP-seq
MIRT2036444	hsa-miR-3918	CLIP-seq
MIRT2036448	hsa-miR-4512	CLIP-seq
MIRT2036449	hsa-miR-4685-5p	CLIP-seq
MIRT2036450	hsa-miR-4722-3p	CLIP-seq
MIRT2036452	hsa-miR-4763-3p	CLIP-seq
MIRT2036454	hsa-miR-486-3p	CLIP-seq
MIRT2266701	hsa-miR-1224-3p	CLIP-seq
MIRT2566311	hsa-miR-1908	CLIP-seq
MIRT2566312	hsa-miR-3622b-5p	CLIP-seq
MIRT2566313	hsa-miR-3688-5p	CLIP-seq
MIRT2566314	hsa-miR-4474-3p	CLIP-seq
MIRT2036445	hsa-miR-4492	CLIP-seq
MIRT2036446	hsa-miR-4498	CLIP-seq
MIRT2036447	hsa-miR-4505	CLIP-seq
MIRT2036451	hsa-miR-4731-5p	CLIP-seq
MIRT2566315	hsa-miR-663	CLIP-seq
MIRT2036455	hsa-miR-762	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8536694, 10801775
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	19801649
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004706	Function	JUN kinase kinase kinase activity	IBA
GO:0004706	Function	JUN kinase kinase kinase activity	ISS	8195146
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	20936779, 32707033
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18455992
GO:0006915	Process	Apoptotic process	TAS	10801775
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	10801775
GO:0007224	Process	Smoothened signaling pathway	IMP	18455992
GO:0007254	Process	JNK cascade	TAS	10801775
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	19801649
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	19801649
GO:0042803	Function	Protein homodimerization activity	ISS	8195146
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043425	Function	BHLH transcription factor binding	IPI	19801649
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	19801649
GO:0043507	Process	Positive regulation of JUN kinase activity	IMP	17584736
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	19801649
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IMP	17584736
GO:0046777	Process	Protein autophosphorylation	ISS	8195146
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 600137
• HGNC: 6849
• e!Ensembl: ENSG00000130758

Protein

• UniProt ID: Q02779
• Protein name: Mitogen-activated protein kinase kinase kinase 10 (EC 2.7.11.25) (Mixed lineage kinase 2) (Protein kinase MST)
• Protein function: Activates the JUN N-terminal pathway.
• PDB: 2RF0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14604	SH3_9	23 → 77	Variant SH3 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	98 → 357	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain and skeletal muscle.
• Sequence:

  MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
  GQLPSGRVGVFPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
  EVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
  ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
  DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
  VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
  EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
  RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGF
  EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSR
  GGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHT
  PIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEPTPSAPP
  ARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRG
  LSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP
  PAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRRTPSDGALGQRGPP
  EPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWK
  LVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH

• Sequence length: 954

Pathways

KEGG Pathway

MAPK signaling pathway

Huntington disease

Pathways of neurodegeneration - multiple diseases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (37)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	26022158		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23178452		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23189122		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23189122		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	28767012		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25307264		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21104395, 26022559		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23027623, 29074106		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23027623, 25541970	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29846174		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25476127	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29846174		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29607163		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31589170		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21104395, 26022559		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30969006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23178452, 30072378		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26022559, 27221886		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23027623, 29074106		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28487647		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31029779		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37137439	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	26451068, 30644090		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27341628, 28197608, 28520570		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	9767613		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29978257		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25307264, 28214207		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23178452, 30072378		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28767012, 30053860, 31203176		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30093562		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	30853885		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	9668102		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for MAP3K10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MAP3K10.