Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5609
Gene name	Mitogen-activated protein kinase kinase 7
Gene symbol	MAP2K7
Synonyms (NCBI Gene)	JNKK2MAPKK7MEKMEK 7MKK7PRKMK7SAPKK-4SAPKK4
Chromosome	19
Chromosome location	19p13.2
Summary	The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase k

321

Show/Hide all (321)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045769	hsa-miR-125a-5p	CLASH	23622248
MIRT054426	hsa-miR-493-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	24533778
MIRT054426	hsa-miR-493-3p	ImmunohistochemistryLuciferase reporter assayWestern blot	24533778
MIRT502019	hsa-miR-4311	PAR-CLIP	24398324
MIRT473843	hsa-miR-8080	PAR-CLIP	23592263
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT473840	hsa-miR-2278	PAR-CLIP	23592263
MIRT473839	hsa-miR-3125	PAR-CLIP	23592263
MIRT473838	hsa-miR-3916	PAR-CLIP	23592263
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT473832	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473831	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473830	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473829	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473828	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473827	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473826	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473825	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473823	hsa-miR-4458	PAR-CLIP	23592263
MIRT473824	hsa-miR-4500	PAR-CLIP	23592263
MIRT473822	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473820	hsa-miR-6077	PAR-CLIP	23592263
MIRT473818	hsa-miR-4451	PAR-CLIP	23592263
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT440290	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440290	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473839	hsa-miR-3125	PAR-CLIP	26701625
MIRT473839	hsa-miR-3125	PAR-CLIP	26701625
MIRT473838	hsa-miR-3916	PAR-CLIP	26701625
MIRT473838	hsa-miR-3916	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	26701625
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473820	hsa-miR-6077	PAR-CLIP	26701625
MIRT473820	hsa-miR-6077	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT473843	hsa-miR-8080	PAR-CLIP	26701625
MIRT473843	hsa-miR-8080	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT502019	hsa-miR-4311	PAR-CLIP	27292025
MIRT734747	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCR	33921710
MIRT736015	hsa-miR-331-3p	Luciferase reporter assayWestern blottingqRT-PCR	32776229
MIRT502019	hsa-miR-4311	PAR-CLIP	24398324
MIRT473843	hsa-miR-8080	PAR-CLIP	23592263
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT473840	hsa-miR-2278	PAR-CLIP	23592263
MIRT473839	hsa-miR-3125	PAR-CLIP	23592263
MIRT473838	hsa-miR-3916	PAR-CLIP	23592263
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT473832	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473831	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473830	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473829	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473828	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473827	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473826	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473825	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473823	hsa-miR-4458	PAR-CLIP	23592263
MIRT473824	hsa-miR-4500	PAR-CLIP	23592263
MIRT473822	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473820	hsa-miR-6077	PAR-CLIP	23592263
MIRT473818	hsa-miR-4451	PAR-CLIP	23592263
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT1128094	hsa-let-7a	CLIP-seq
MIRT1128095	hsa-let-7b	CLIP-seq
MIRT1128096	hsa-let-7c	CLIP-seq
MIRT1128097	hsa-let-7d	CLIP-seq
MIRT1128098	hsa-let-7e	CLIP-seq
MIRT1128099	hsa-let-7f	CLIP-seq
MIRT1128100	hsa-let-7g	CLIP-seq
MIRT1128101	hsa-let-7i	CLIP-seq
MIRT1128102	hsa-miR-1287	CLIP-seq
MIRT1128103	hsa-miR-1538	CLIP-seq
MIRT1128104	hsa-miR-1908	CLIP-seq
MIRT1128105	hsa-miR-1909	CLIP-seq
MIRT1128106	hsa-miR-2861	CLIP-seq
MIRT1128107	hsa-miR-3150a-3p	CLIP-seq
MIRT1128108	hsa-miR-3175	CLIP-seq
MIRT1128109	hsa-miR-3180	CLIP-seq
MIRT1128110	hsa-miR-3180-3p	CLIP-seq
MIRT1128111	hsa-miR-3187-3p	CLIP-seq
MIRT1128112	hsa-miR-3196	CLIP-seq
MIRT1128113	hsa-miR-3689a-3p	CLIP-seq
MIRT1128114	hsa-miR-3689c	CLIP-seq
MIRT1128115	hsa-miR-3927	CLIP-seq
MIRT1128116	hsa-miR-4529-5p	CLIP-seq
MIRT1128117	hsa-miR-4532	CLIP-seq
MIRT1128118	hsa-miR-4640-5p	CLIP-seq
MIRT1128119	hsa-miR-4651	CLIP-seq
MIRT1128120	hsa-miR-4726-5p	CLIP-seq
MIRT1128121	hsa-miR-4745-3p	CLIP-seq
MIRT1128122	hsa-miR-4747-3p	CLIP-seq
MIRT1128123	hsa-miR-491-5p	CLIP-seq
MIRT1128124	hsa-miR-603	CLIP-seq
MIRT1128125	hsa-miR-608	CLIP-seq
MIRT1128126	hsa-miR-663	CLIP-seq
MIRT1128127	hsa-miR-663b	CLIP-seq
MIRT1128128	hsa-miR-939	CLIP-seq
MIRT1128129	hsa-miR-98	CLIP-seq
MIRT1551118	hsa-miR-1197	CLIP-seq
MIRT2036417	hsa-miR-1913	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT1128111	hsa-miR-3187-3p	CLIP-seq
MIRT2036419	hsa-miR-3189-5p	CLIP-seq
MIRT2036420	hsa-miR-3191	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2036422	hsa-miR-324-3p	CLIP-seq
MIRT2036423	hsa-miR-328	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2036426	hsa-miR-370	CLIP-seq
MIRT2036427	hsa-miR-4287	CLIP-seq
MIRT2036428	hsa-miR-4292	CLIP-seq
MIRT2036429	hsa-miR-4313	CLIP-seq
MIRT2036430	hsa-miR-4447	CLIP-seq
MIRT2036431	hsa-miR-4472	CLIP-seq
MIRT1128116	hsa-miR-4529-5p	CLIP-seq
MIRT1128119	hsa-miR-4651	CLIP-seq
MIRT2036432	hsa-miR-4685-3p	CLIP-seq
MIRT2036433	hsa-miR-4758-3p	CLIP-seq
MIRT2036434	hsa-miR-4780	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2036436	hsa-miR-541	CLIP-seq
MIRT1128124	hsa-miR-603	CLIP-seq
MIRT1128125	hsa-miR-608	CLIP-seq
MIRT2036437	hsa-miR-623	CLIP-seq
MIRT2036438	hsa-miR-654-5p	CLIP-seq
MIRT1128127	hsa-miR-663b	CLIP-seq
MIRT2036439	hsa-miR-670	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq
MIRT1128094	hsa-let-7a	CLIP-seq
MIRT1128095	hsa-let-7b	CLIP-seq
MIRT1128096	hsa-let-7c	CLIP-seq
MIRT1128097	hsa-let-7d	CLIP-seq
MIRT1128098	hsa-let-7e	CLIP-seq
MIRT1128099	hsa-let-7f	CLIP-seq
MIRT1128100	hsa-let-7g	CLIP-seq
MIRT1128101	hsa-let-7i	CLIP-seq
MIRT2266663	hsa-miR-1234	CLIP-seq
MIRT2266664	hsa-miR-125b	CLIP-seq
MIRT2266665	hsa-miR-128	CLIP-seq
MIRT1128102	hsa-miR-1287	CLIP-seq
MIRT2266666	hsa-miR-141	CLIP-seq
MIRT2266667	hsa-miR-1468	CLIP-seq
MIRT1128105	hsa-miR-1909	CLIP-seq
MIRT2266668	hsa-miR-1976	CLIP-seq
MIRT2266669	hsa-miR-200a	CLIP-seq
MIRT2266670	hsa-miR-27a	CLIP-seq
MIRT2266671	hsa-miR-27b	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT2266672	hsa-miR-3150b-3p	CLIP-seq
MIRT2266673	hsa-miR-3179	CLIP-seq
MIRT2036419	hsa-miR-3189-5p	CLIP-seq
MIRT2036420	hsa-miR-3191	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2266674	hsa-miR-329	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2266675	hsa-miR-362-3p	CLIP-seq
MIRT1128113	hsa-miR-3689a-3p	CLIP-seq
MIRT1128114	hsa-miR-3689c	CLIP-seq
MIRT2036426	hsa-miR-370	CLIP-seq
MIRT1128115	hsa-miR-3927	CLIP-seq
MIRT2266676	hsa-miR-421	CLIP-seq
MIRT2266677	hsa-miR-4319	CLIP-seq
MIRT2266678	hsa-miR-4431	CLIP-seq
MIRT2266679	hsa-miR-4438	CLIP-seq
MIRT2036430	hsa-miR-4447	CLIP-seq
MIRT2036431	hsa-miR-4472	CLIP-seq
MIRT2266680	hsa-miR-4493	CLIP-seq
MIRT2266681	hsa-miR-4522	CLIP-seq
MIRT1128116	hsa-miR-4529-5p	CLIP-seq
MIRT2266682	hsa-miR-4640-3p	CLIP-seq
MIRT1128118	hsa-miR-4640-5p	CLIP-seq
MIRT1128119	hsa-miR-4651	CLIP-seq
MIRT2266683	hsa-miR-4667-3p	CLIP-seq
MIRT2266684	hsa-miR-4709-5p	CLIP-seq
MIRT2266685	hsa-miR-4714-5p	CLIP-seq
MIRT1128120	hsa-miR-4726-5p	CLIP-seq
MIRT2266686	hsa-miR-4732-3p	CLIP-seq
MIRT2266687	hsa-miR-4753-5p	CLIP-seq
MIRT2266688	hsa-miR-4755-3p	CLIP-seq
MIRT2036433	hsa-miR-4758-3p	CLIP-seq
MIRT2266689	hsa-miR-4762-3p	CLIP-seq
MIRT2266690	hsa-miR-4784	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2266691	hsa-miR-4793-5p	CLIP-seq
MIRT2266692	hsa-miR-485-5p	CLIP-seq
MIRT2266693	hsa-miR-493	CLIP-seq
MIRT2266694	hsa-miR-505	CLIP-seq
MIRT2266695	hsa-miR-513a-5p	CLIP-seq
MIRT2036436	hsa-miR-541	CLIP-seq
MIRT2266696	hsa-miR-548n	CLIP-seq
MIRT2266697	hsa-miR-548t	CLIP-seq
MIRT2266698	hsa-miR-561	CLIP-seq
MIRT1128124	hsa-miR-603	CLIP-seq
MIRT2266699	hsa-miR-604	CLIP-seq
MIRT1128125	hsa-miR-608	CLIP-seq
MIRT2266700	hsa-miR-626	CLIP-seq
MIRT2036438	hsa-miR-654-5p	CLIP-seq
MIRT2036439	hsa-miR-670	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq
MIRT1128129	hsa-miR-98	CLIP-seq
MIRT2390556	hsa-miR-1291	CLIP-seq
MIRT2390557	hsa-miR-1914	CLIP-seq
MIRT2036423	hsa-miR-328	CLIP-seq
MIRT2390558	hsa-miR-3649	CLIP-seq
MIRT2036428	hsa-miR-4292	CLIP-seq
MIRT2566310	hsa-miR-1470	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2266683	hsa-miR-4667-3p	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq
MIRT2566310	hsa-miR-1470	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2266683	hsa-miR-4667-3p	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	9535930
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004707	Function	MAP kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	IDA	9535930
GO:0004708	Function	MAP kinase kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15299019, 16533805, 16840345, 17110930, 17709393, 18286207, 20067578, 22939624, 25241761, 25314077, 32707033, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006970	Process	Response to osmotic stress	IDA	9535930
GO:0007165	Process	Signal transduction	TAS	9535930
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	ISS
GO:0007254	Process	JNK cascade	TAS
GO:0008545	Function	JUN kinase kinase activity	IBA
GO:0008545	Function	JUN kinase kinase activity	IEA
GO:0008545	Function	JUN kinase kinase activity	ISS
GO:0008545	Function	JUN kinase kinase activity	TAS
GO:0009408	Process	Response to heat	IDA	9535930
GO:0009411	Process	Response to UV	IDA	9535930
GO:0009611	Process	Response to wounding	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	14615289
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	14697235
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	21531765
GO:0034612	Process	Response to tumor necrosis factor	IDA	9535930
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	28111074
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051403	Process	Stress-activated MAPK cascade	IBA
GO:0051403	Process	Stress-activated MAPK cascade	IDA	9535930
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	28111074
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140677	Function	Molecular function activator activity	EXP	25737554
GO:2000671	Process	Regulation of motor neuron apoptotic process	IEA

MIM	HGNC	e!Ensembl
603014	6847	ENSG00000076984

O14733

Protein name

Dual specificity mitogen-activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK-activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress-activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK-4) (SAPKK4) (c-Jun N-terminal

Protein function

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K4/MKK4,

PDB

2DYL , 3WZU , 4UX9 , 5B2K , 5B2L , 5B2M , 5Y8U , 5Y90 , 5Z1D , 5Z1E , 6IB0 , 6IB2 , 6QFL , 6QFR , 6QFT , 6QG4 , 6QG7 , 6QHO , 6QHR , 6YFZ , 6YG0 , 6YG1 , 6YG2 , 6YG3 , 6YG4 , 6YG5 , 6YG6 , 6YG7 , 6YZ4 , 7CBX , 7OVI , 7OVJ , 7OVK , 7OVL , 7OVM , 7OVN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	120 → 380	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle. {ECO:0000269|PubMed:16442502, ECO:0000269|PubMed:9372971, ECO:0000269|PubMed:9535930}.

Sequence

MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR

Sequence length

419

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	other	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (388)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	31805013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10339498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27979926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	17077328, 30635434, 31056348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17077328, 28404891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	29509940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24037752, 31320402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21122157, 22684718, 24469055, 26301689, 27821489, 28554329, 28982179, 29336889, 30635434, 30864727, 31200834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29330049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	27903124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	12709419, 29930101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	29043551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	30501438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	29388014, 31781502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	29388014, 35689405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	16601293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	25981859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27797976, 29072975, 30464041, 30539168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	40406144	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	11050091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26228206, 27145457, 28537897, 29213099, 29740790, 30065098, 30154150, 30261145, 30537492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	28076932, 30816458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28007744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	35343049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28890347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	13130464, 16802349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11959794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27683117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27810072, 30575814, 37280243, 40565357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28007744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	25638158		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26035796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	24174471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	26683364, 29024814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	26683364, 30563938, 31312030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22049531, 24442130, 26312564, 28388658, 28881802, 30482227, 30881113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30907511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19082503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34625515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	29632053, 30265855, 31466300, 31675726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16419029, 17516844, 20591134, 21499305, 22927430, 23404856, 23531216, 24403602, 24486524, 24938872, 26384399, 27313062, 27557506, 28183251, 28928458 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21317887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12838322, 15723837, 19317917, 19352700, 19514121, 19853943, 19952304, 20471474, 20591134, 20679487, 21278786, 21869603, 22105362, 22447278, 23127286 View all (17 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	22565394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12692057, 15729718, 22039425, 22121046, 22146979, 22147942, 23959801, 26156586, 31661126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	12851216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15141374, 21220306, 23211466, 24184540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19321179, 19698189, 21316602, 21507240, 25794709, 26586395, 26620707, 28560380, 28877210, 29449645, 29763915, 30815935, 31852247, 33210432, 36137220, 37626338 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	16498399, 27212661, 34724284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22049531, 24442130, 26312564, 28388658, 28881802, 30482227, 30881113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16354319, 19997650, 20885957, 21122157, 22560902, 22753015, 23102728, 23658296, 25697899, 25801412, 26036643, 27028764, 27121230, 27154822, 27922010 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22543706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17353198, 23918833, 26251290, 29298720, 30261145, 31583713, 36694355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26097571, 30048489, 31438640, 32331211, 32413671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	37189139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22389437	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24037752, 32521923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19190345, 28556451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26232337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	27048246, 30036245, 31672771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22543706, 23390495, 26324360, 27058837, 27980105, 28062115, 28545687, 28766096, 29435137, 29844129, 29959144, 31043489, 31082584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	BEFREE	17366577, 17981815, 18413255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome	Pubtator	17704260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	35052347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36896641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37534686	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	30821092, 30963251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	25479176, 30412737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36168877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29604594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29604594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25504635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	12709419, 29930101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12692057, 23391555, 30400838	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16950403, 28441383, 29348467, 30741922		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	10765924, 31809267, 37928274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	24445144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17928528, 23088640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24812670, 30730307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	21284947		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30972290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26034353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19331159, 24533778, 24685132, 27655129, 28759045, 30218856, 30482246, 30579838, 30706361, 30858154, 30944457, 30980281, 31227518, 31554653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15150094, 24533778, 30833665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15757891, 25885658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18436711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18428050, 19679059, 19686845, 20413844, 20923857, 21118963, 21199803, 21985784, 23757356, 24576621, 24931611, 25174975, 25199829, 25813020, 26300397 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10584870	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12077118, 12676582, 19372556, 19686845, 20413844, 21071512, 21170361, 22569000, 22773810, 22909976, 23438367, 23624914, 23757356, 24330663, 24533778 View all (52 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30550927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29763915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	17294242, 30741922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	21284947		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26487278, 30048489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Costello Syndrome	Costello syndrome	Pubtator	17704260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	17704260, 19035362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	27903124, 29952427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	28425764, 29509940, 37683921, 39976897, 40128998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16007203, 24576830, 28325255, 30205280, 30681641, 30835257, 31200439, 31514399, 31753111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30237062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28688265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30537078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	17704260, 32155425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	23352452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	30676433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28816409, 30356368, 30773997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28137583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37635064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	34331515	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	28291381, 28423638, 30053080, 31186313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29572378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29416002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	21220498, 27104757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22459351, 28336232, 28498246, 29426295, 31623857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19432902, 23674493, 28498246, 29426295, 30445932, 31623857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15299092, 27619769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30281322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	17110434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28062115, 29844129, 31043489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	19788444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erdheim-Chester Disease	Erdheim-Chester Disease	BEFREE	26110571, 31740567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27933650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27933650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32831056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25620088, 25915860, 28927233, 32945416, 33880577, 36848349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	14648701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20739640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	23354306, 29750576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29463989, 31418419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23391555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	34436699	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18615679, 22773810, 27777072, 33472910, 37475847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	27777072, 31213500, 31268158, 31308077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	28349920		★★★★★ ★☆☆☆☆ Found in Text Mining only
GIANT PIGMENTED HAIRY NEVUS	Large congenital melanocytic nevus	BEFREE	25815427, 31445573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15618223, 19458076, 22077956, 25913706, 27132626, 27884160, 30289729, 35269397, 37277696, 37481865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20857497, 25432173, 30016974, 30018734, 30647839, 31217909, 31345255, 31390677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20857497, 24676782, 25432173, 30016974, 30018734, 30647839, 31217909, 31345255, 31390677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19176641, 20615395, 27494648, 27713119, 27848137, 28469970, 30548577, 30676433, 30963560, 31390677, 31466300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22520038, 23991044, 27884160, 30085274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28640105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	31318944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	23940728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	28872488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	21663470, 23349307, 23518796, 25563425, 31187521, 31628266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36769112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	21284947		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	21284947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	29872503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26202951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	27741509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29763915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22114332	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	32871763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	18428050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	26566875, 28854169, 30098202, 31768065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	26110571, 26637773, 27314817, 27597420, 28679432, 29768711, 30098202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12689928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23732116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	30501438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	21505178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21698228, 24117380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27774567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28465444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	29444910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	34436699	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29348467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	18024410, 23221337, 24569456, 24812670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kabuki make-up syndrome	Kabuki Syndrome	BEFREE	30018450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	30548577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31804622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28640105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28396940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35108425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	32791689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	28002802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	21284947		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	LEOPARD Syndrome	BEFREE	22681964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12642693, 15494423, 15517875, 17949889, 18394702, 19773546, 20362031, 20836852, 24589925, 25480661, 31646826, 32862609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16446383, 19342098, 24795008, 26237430, 27872496, 28235190, 28372922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	21663470, 23349307, 25480661, 25700421, 38440808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10339498, 11238126, 11560954, 17077328, 19773546, 23825585, 24739393, 27036514, 27074819, 27249593, 28235190, 30635233, 30799283, 31123034, 32882760, 33375770, 37629110 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	40406144	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	18024410, 23620576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	17077328, 18445086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11560954, 17077328, 20221697, 23535559, 24116827, 24569456, 26111466, 28235190, 28408400, 30635434, 31056348, 31123034, 31645898, 31648326, 31718075, 31819100 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	23221337, 30367142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	29043551		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	28002802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	22240207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26518767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19816936, 21744342, 22159816, 22425622, 24807674, 24969837, 26004137, 26386721, 27628214, 27713963, 27956228, 28276530, 28877210, 29282298, 29330146 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21744342, 22159816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31669429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18424438, 19010912, 19783898, 20885957, 22753015, 22948716, 23815882, 25351745, 26560124, 26901483, 29079711, 29132432, 29961751, 30022688, 31668570, 37189139, 38109210, 40597801 View all (3 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	20215513, 27922010, 29386539, 29945997, 30205046, 30771521		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21317887		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	24908424	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23775084, 33282947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	30947262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28471834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11106658, 20117835	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	26961147		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma Follicular	Lymphoma	Pubtator	18682601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	18428050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	28759024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16419029, 17516844, 20591134, 21499305, 22105362, 22927430, 23404856, 23531216, 24403602, 24486524, 24938872, 26384399, 27313062, 27557506, 28183251 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21317887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28336232, 28498246, 29426295, 31623857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27933650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18521085, 23589362, 30030148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16354319, 20885957, 21122157, 22560902, 22753015, 22773810, 23102728, 23515407, 23658296, 24675361, 25351745, 25697899, 25801412, 26036643, 26667343 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21317887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	22240207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	22565394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23390495, 26324360, 27058837, 27980105, 28545687, 28766096, 29435137, 29959144, 31043489, 31082584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14598883, 15572689, 15930308, 22952903, 23407711, 24264800, 25117978, 25167228, 25376606, 25736685, 26505547, 27034160, 28537897, 28595260, 28957417 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20853079, 21266977, 21930937, 22200661, 23838318, 25070358, 26983806, 29959569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19142899, 25253779, 26081723, 30466782, 30655678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	18651802, 21351275, 27179656, 28445948, 28910386, 31186313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22049531, 24442130, 26312564, 28388658, 28881802, 30482227, 30881113, 31554791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12569580, 12727824, 17194493, 17208430, 18413255, 19217204, 19574224, 19850869, 20526349, 20923857, 21220498, 21729876, 21791114, 22922669, 22970192 View all (83 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	23221341, 24681606, 27477693, 27494873, 28469964, 29131833, 29720369, 29854299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	31285959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29604594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12676582, 19331159, 22773810, 24533778, 24685132, 25961376, 27655129, 28759045, 29312543, 30218856, 30482246, 30579838, 30706361, 30858154, 30944457, 30980281, 31227518, 31554653 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21317887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21317887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23404856, 25596742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21317887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	28768908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	30018080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	12709419, 29930101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	12709419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	19919630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus syndrome congenital	Melanocytic nevus	Pubtator	37716647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12917419, 15184373, 16410717, 17050671, 17245336, 17482134, 18008004, 18045987, 18323781, 18386001, 18668140, 18701495, 19078992, 19244105, 19915144 View all (176 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14712208, 16152620, 16845326, 17392427, 18323781, 18790768, 19649202, 19682280, 19747926, 19915144, 20215513, 20401974, 21220306, 21244382, 21527556 View all (232 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	21828154, 24576830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27610895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	16498399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24762959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	16619474, 23817184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29381809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	21139585, 23413975, 24325952, 24403169, 24419498, 24489105, 24504441, 24588908, 24933606, 25145427, 25185693, 25477091, 25623140, 25788221, 25944484 View all (56 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29516570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22447278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26919242, 36901935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	15141374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28467514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12433678, 16418332, 17363736, 20930946, 21163924, 22985491, 23185517, 26630652, 28557972, 29654269, 30846494, 32043788, 32228485, 32747568, 34518309, 34861096, 36115844, 36608320 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20930946, 28096095, 28504689, 30846494, 31628267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34308699	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	34620690, 40406144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21483442, 22169110, 26202951, 29485707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	23221337, 24812670, 27741509, 30829649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	21284947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31217849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22565394, 26058873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29364482, 32964977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	33277860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11435313, 12037682, 16395408, 16899113, 17095020, 18949058, 19190079, 19850869, 20088787, 20215513, 20401974, 20609351, 20923857, 21071512, 21505228 View all (187 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	28433687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31708743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12668729, 12710931, 16120441, 26121087, 26734995, 26821351, 27729458, 28604107, 28666189, 29184034, 30266481, 9275096		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	22948716, 26384788, 26517508, 26821351, 26925841, 31672841, 36135081, 36398965	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27943621, 28854169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22178087, 27048246, 31158244, 9421477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	23221341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	23221341, 24681606, 27477693, 29131833, 29477258, 30931649, 30963251, 31141829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	32608378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	27494873, 33452215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30094097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29381809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22037177, 22131876, 23200175, 23270470, 24108744, 24675361, 24908424, 25706985, 25801412, 26019170, 26108998, 26325669, 26623721, 26723875, 26893312 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	17704260, 35052347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	21041952, 22681964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome 1	Noonan Syndrome	BEFREE	22563505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Optic Nerve Glioma	BEFREE	25534823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	13130464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30124538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30124538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	27179639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21378337, 29323740, 30277613, 31517733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22506069, 23403511, 30135419, 37591850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23390495, 27980105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	25756515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16815388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26324360, 27058837, 28545687, 28766096, 29435137, 29959144, 31043489, 31082584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20661131, 22543706, 23820584, 26526982, 27129169, 31159852, 31395751, 32291856, 33000231, 33043759, 34794740, 36245227, 36362153, 37445830, 37779141, 38109210 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	27617337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10871844, 14598883, 15572689, 15930308, 22952903, 24264800, 25117978, 25167228, 25376606, 25736685, 26505547, 27034160, 28537897, 28595260, 28957417 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29808009, 30537492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22952903, 30254182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16311341, 19671674, 21386633, 23180942, 23764046, 23918833, 24294133, 24301926, 24392017, 25167228, 25271986, 25961376, 26251290, 28957417, 30261145 View all (10 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	29444910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	27610895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	25788221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	26563980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15980887, 16181240, 21249150, 22535643, 25085839, 28423638, 31085763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	25788221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30877973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31583713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	28640835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	27810072, 30575814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	30120661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	31141829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	10760082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	21697238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	31824842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	27054332, 30266823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27979926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27872496, 28479419, 30232463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20853079, 21266977, 21930937, 22200661, 23838318, 25070358, 26983806, 29959569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	21081304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16847055, 21081304, 21871886, 23991415, 25971429, 26983806, 29898731, 30804427, 32264916, 32492656, 32851058, 33277863, 34183450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32063702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	24465776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	23975835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28341395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26487278, 30048489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30530834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	30682205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30255823, 30681641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	30255823	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21725359, 25070358, 26369631, 26728409, 30191630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30664191, 31115482, 34036380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	16351709, 16899113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	16899113, 23684925, 29437705, 29973406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	35801577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	13130464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14734742, 16802349, 19818765, 28341395, 29511118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	Pubtator	35999193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	31612562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	33312171	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23354306, 23858101, 28377484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	16699017, 17964626, 36674756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22899651, 27774567, 30691477, 31219577		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22899651		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwannomatosis	Schwannomatosis	Pubtator	33025139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	18240216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23757356, 25322874, 26392102, 27636997, 28374784, 29471699, 30042150, 31704811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	31669429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	37534686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23844038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	9421477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26287334, 37820992, 9421477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	25150293, 27940476, 29485431, 31740567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25788221, 25939760, 27027432, 28556451, 30806895, 31285959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22965424, 25175641, 25620088, 29855346, 31783401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20927317, 28151720, 31118072, 33227411, 36769112, 36916400, 38030062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30987362, 31019292, 31089135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	28151720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27848137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20927317, 26053277, 30343534, 30546955, 31285959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	31620898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	29215399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20739640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19142899, 25253779, 26081723, 30466782, 30655678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	22442341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19924065, 21047770, 21698158, 22821546, 23228105, 25448881, 26810190, 28350126, 28460635, 29666306, 29668670, 30015980, 34002670, 35866593, 37037864, 37691391 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31708743		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28350009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18240216		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	12490193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	15980887, 28423638, 31085763, 36799665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	18651802, 21351275, 25269412, 26384551, 27179656, 28445948, 28910386, 31186313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31077090, 37675898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18651802, 21351275, 27179656, 28445948, 28910386, 30459933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18651802, 20332228, 22090271, 22641097, 25867065, 26828826, 28423638, 31882478, 37932340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	26828826, 27852061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	24174471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22500798, 25959272, 26384399, 27528706, 27563827, 28108460, 28465444, 28576487, 28928458, 31527768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26537583, 29801480, 31527768, 32504034, 34168046, 37185776, 37879215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15704157, 23371318, 31102937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22049531, 28388658, 28534984, 32865871, 36045117, 36142409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23618899, 30288546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29516570, 31703640, 35015607, 35659173, 37754347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	30281322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	16410717, 21828154, 22550165, 22733540, 24551032, 26059332, 28138035, 33126538, 33229459, 35332245, 36212716	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	22733540, 22808163, 23443802, 23464620, 24141786, 24413085, 24899684, 30205280, 31173078, 31227503, 31758842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	BEFREE	30222658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	30939167		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	30939167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	32238401, 36455140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP2K7 (mitogen-activated protein kinase kinase 7)